Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3K1L8

Protein Details
Accession J3K1L8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
97-116EYGARERLRVREKHRPREQGBasic
NLS Segment(s)
PositionSequence
109-110KH
Subcellular Location(s) cysk 9, mito 7, cyto 5.5, extr 4, cyto_nucl 4
Family & Domain DBs
KEGG cim:CIMG_09097  -  
Amino Acid Sequences MLTIWFVDVASFTSWEVVGRDDIAGQPSSRRWQQCHSERLEGQAVVAAGGAGGGGRWWGQAGEVIQQKEKIPIWWLEKRREEEDEQREQRANLGLSEYGARERLRVREKHRPREQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.1
5 0.1
6 0.1
7 0.1
8 0.09
9 0.1
10 0.12
11 0.12
12 0.11
13 0.13
14 0.15
15 0.21
16 0.26
17 0.29
18 0.3
19 0.37
20 0.47
21 0.53
22 0.58
23 0.57
24 0.57
25 0.53
26 0.54
27 0.49
28 0.38
29 0.3
30 0.23
31 0.18
32 0.12
33 0.11
34 0.07
35 0.04
36 0.04
37 0.03
38 0.02
39 0.02
40 0.01
41 0.02
42 0.02
43 0.02
44 0.02
45 0.03
46 0.03
47 0.04
48 0.05
49 0.1
50 0.13
51 0.14
52 0.15
53 0.16
54 0.17
55 0.19
56 0.19
57 0.15
58 0.14
59 0.19
60 0.25
61 0.31
62 0.36
63 0.41
64 0.47
65 0.51
66 0.52
67 0.51
68 0.5
69 0.52
70 0.53
71 0.56
72 0.52
73 0.51
74 0.49
75 0.44
76 0.42
77 0.36
78 0.3
79 0.2
80 0.2
81 0.16
82 0.16
83 0.17
84 0.15
85 0.13
86 0.15
87 0.15
88 0.16
89 0.19
90 0.27
91 0.35
92 0.42
93 0.49
94 0.57
95 0.68
96 0.76