Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015JFW7

Protein Details
Accession A0A015JFW7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
177-200YSPAITKPKPPRPKSPSPPRVIKAHydrophilic
NLS Segment(s)
PositionSequence
183-196KPKPPRPKSPSPPR
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027329  TPX2_C  
IPR027330  TPX2_central_dom  
IPR009675  TPX2_fam  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005874  C:microtubule  
GO:0005634  C:nucleus  
GO:0005819  C:spindle  
GO:0032147  P:activation of protein kinase activity  
GO:0060236  P:regulation of mitotic spindle organization  
Pfam View protein in Pfam  
PF06886  TPX2  
PF12214  TPX2_importin  
Amino Acid Sequences MDATNFNNDKPEVVEKFEYMEDVSRVMSVTSSTRSPQTKNYLANKCGGIQKRAFVPTVPKPFKFYTESWANNSCNKENSPKSPFIPLALSVQQFLDNPTRFDAKSDKVRSNTLTEPKSPYLRTKYRSKPTTILPTEERKIREMRGYRFKANPLDRKILENRNFGIPKVQKPKLTEPYSPAITKPKPPRPKSPSPPRVIKANPVPDYKEPYRPVLEHRLIELPVFNLPGEEISKRKSQEIEERIRQEKERMEKMREFKAQPLLTGSPDCLPTRPYHPPTHPKPFALLTNDRGEKYQREFYEKVRKEQEYIKESRFHAQPLPNFEPKIPRKPECPPPTEPIGFFFFTDTRMEERHIYDEHRRFREKEAEEQRIAKIMEEEVRSAEEIHRLRADLVHHAQPIRYYTPINIQPSDKKSTRPISPMIGEKRRKYMQMLDNYEGRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.3
3 0.32
4 0.32
5 0.29
6 0.22
7 0.23
8 0.18
9 0.16
10 0.16
11 0.13
12 0.13
13 0.12
14 0.11
15 0.09
16 0.12
17 0.14
18 0.16
19 0.18
20 0.25
21 0.29
22 0.32
23 0.39
24 0.45
25 0.49
26 0.56
27 0.64
28 0.66
29 0.63
30 0.65
31 0.58
32 0.53
33 0.54
34 0.5
35 0.47
36 0.4
37 0.42
38 0.44
39 0.45
40 0.42
41 0.36
42 0.39
43 0.42
44 0.51
45 0.53
46 0.47
47 0.5
48 0.51
49 0.54
50 0.52
51 0.44
52 0.41
53 0.44
54 0.47
55 0.46
56 0.51
57 0.48
58 0.48
59 0.52
60 0.46
61 0.41
62 0.41
63 0.45
64 0.44
65 0.5
66 0.51
67 0.51
68 0.5
69 0.53
70 0.5
71 0.43
72 0.39
73 0.32
74 0.3
75 0.29
76 0.28
77 0.22
78 0.22
79 0.21
80 0.18
81 0.2
82 0.24
83 0.2
84 0.21
85 0.23
86 0.26
87 0.25
88 0.28
89 0.3
90 0.28
91 0.37
92 0.42
93 0.46
94 0.45
95 0.49
96 0.49
97 0.49
98 0.49
99 0.47
100 0.45
101 0.42
102 0.45
103 0.45
104 0.47
105 0.44
106 0.44
107 0.46
108 0.5
109 0.52
110 0.56
111 0.63
112 0.68
113 0.71
114 0.69
115 0.64
116 0.63
117 0.69
118 0.61
119 0.56
120 0.51
121 0.52
122 0.5
123 0.51
124 0.45
125 0.38
126 0.38
127 0.36
128 0.39
129 0.4
130 0.44
131 0.5
132 0.53
133 0.55
134 0.55
135 0.57
136 0.58
137 0.59
138 0.6
139 0.55
140 0.57
141 0.52
142 0.54
143 0.56
144 0.57
145 0.55
146 0.5
147 0.46
148 0.47
149 0.47
150 0.41
151 0.43
152 0.37
153 0.4
154 0.45
155 0.47
156 0.43
157 0.48
158 0.57
159 0.58
160 0.59
161 0.53
162 0.48
163 0.49
164 0.48
165 0.43
166 0.36
167 0.34
168 0.31
169 0.37
170 0.42
171 0.47
172 0.55
173 0.59
174 0.68
175 0.69
176 0.78
177 0.8
178 0.82
179 0.82
180 0.78
181 0.81
182 0.72
183 0.71
184 0.61
185 0.57
186 0.53
187 0.52
188 0.49
189 0.43
190 0.45
191 0.39
192 0.45
193 0.41
194 0.41
195 0.34
196 0.33
197 0.34
198 0.31
199 0.34
200 0.35
201 0.36
202 0.29
203 0.29
204 0.28
205 0.26
206 0.25
207 0.21
208 0.12
209 0.1
210 0.1
211 0.08
212 0.05
213 0.05
214 0.06
215 0.07
216 0.07
217 0.08
218 0.1
219 0.15
220 0.16
221 0.17
222 0.19
223 0.21
224 0.3
225 0.37
226 0.42
227 0.44
228 0.49
229 0.5
230 0.5
231 0.48
232 0.42
233 0.39
234 0.38
235 0.41
236 0.4
237 0.43
238 0.46
239 0.5
240 0.54
241 0.54
242 0.49
243 0.44
244 0.48
245 0.42
246 0.37
247 0.37
248 0.3
249 0.26
250 0.25
251 0.21
252 0.14
253 0.16
254 0.16
255 0.13
256 0.13
257 0.14
258 0.19
259 0.27
260 0.31
261 0.35
262 0.42
263 0.51
264 0.58
265 0.66
266 0.63
267 0.55
268 0.53
269 0.49
270 0.46
271 0.43
272 0.39
273 0.32
274 0.36
275 0.37
276 0.35
277 0.34
278 0.32
279 0.3
280 0.31
281 0.34
282 0.29
283 0.35
284 0.36
285 0.43
286 0.51
287 0.5
288 0.52
289 0.52
290 0.52
291 0.47
292 0.53
293 0.54
294 0.5
295 0.51
296 0.48
297 0.46
298 0.47
299 0.5
300 0.45
301 0.38
302 0.38
303 0.39
304 0.39
305 0.42
306 0.47
307 0.45
308 0.44
309 0.43
310 0.47
311 0.47
312 0.53
313 0.51
314 0.48
315 0.5
316 0.57
317 0.66
318 0.64
319 0.64
320 0.59
321 0.57
322 0.61
323 0.58
324 0.51
325 0.44
326 0.39
327 0.34
328 0.29
329 0.26
330 0.19
331 0.18
332 0.19
333 0.17
334 0.16
335 0.16
336 0.19
337 0.2
338 0.21
339 0.24
340 0.24
341 0.28
342 0.35
343 0.42
344 0.48
345 0.53
346 0.56
347 0.54
348 0.59
349 0.64
350 0.57
351 0.6
352 0.6
353 0.61
354 0.59
355 0.6
356 0.54
357 0.49
358 0.46
359 0.36
360 0.28
361 0.23
362 0.25
363 0.24
364 0.24
365 0.19
366 0.21
367 0.2
368 0.2
369 0.19
370 0.21
371 0.21
372 0.24
373 0.25
374 0.24
375 0.25
376 0.26
377 0.27
378 0.27
379 0.3
380 0.32
381 0.34
382 0.34
383 0.34
384 0.34
385 0.37
386 0.31
387 0.29
388 0.25
389 0.24
390 0.32
391 0.38
392 0.41
393 0.39
394 0.41
395 0.48
396 0.51
397 0.58
398 0.51
399 0.49
400 0.53
401 0.57
402 0.59
403 0.57
404 0.56
405 0.54
406 0.58
407 0.62
408 0.63
409 0.65
410 0.67
411 0.66
412 0.7
413 0.68
414 0.66
415 0.62
416 0.62
417 0.61
418 0.63
419 0.66
420 0.61