Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015N0F3

Protein Details
Accession A0A015N0F3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
235-259LIKNSEEKENGRRKRNNRRNQYSAYHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR006214  Bax_inhibitor_1-related  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01027  Bax1-I  
Amino Acid Sequences MSTFGSTFGDRNNFSTFEAFKNVSDLTKPIQQHLIKVYSTLAVLCLLTAAGSYAHITGLFLFGGGLLSFLVGLVSLIGISFLPDTPNNKNIRYGLLFNFAFMEGLSIGPLIDHALNINSSGQIVLLATTFTSLIFGSFSLSSLLSNKRTFIYLGGILASAVSMLFWMAFFNAFIGSKLLYTAELYLGLFVFCGYVIYDTQLIVYRATLGSRDVVRHTLELFIDLIAIFVRILYILIKNSEEKENGRRKRNNRRNQYSAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.29
4 0.25
5 0.29
6 0.28
7 0.24
8 0.26
9 0.25
10 0.22
11 0.22
12 0.21
13 0.2
14 0.25
15 0.25
16 0.25
17 0.33
18 0.33
19 0.35
20 0.39
21 0.39
22 0.33
23 0.33
24 0.31
25 0.23
26 0.22
27 0.18
28 0.12
29 0.09
30 0.09
31 0.07
32 0.07
33 0.05
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.05
40 0.05
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.05
48 0.05
49 0.04
50 0.05
51 0.05
52 0.05
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.03
67 0.04
68 0.04
69 0.06
70 0.08
71 0.12
72 0.15
73 0.23
74 0.25
75 0.26
76 0.28
77 0.27
78 0.3
79 0.29
80 0.28
81 0.23
82 0.27
83 0.26
84 0.23
85 0.23
86 0.19
87 0.16
88 0.13
89 0.12
90 0.05
91 0.05
92 0.05
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.05
103 0.05
104 0.06
105 0.05
106 0.05
107 0.05
108 0.04
109 0.04
110 0.04
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.04
119 0.03
120 0.04
121 0.04
122 0.04
123 0.05
124 0.05
125 0.06
126 0.06
127 0.06
128 0.06
129 0.09
130 0.12
131 0.14
132 0.14
133 0.15
134 0.15
135 0.16
136 0.16
137 0.14
138 0.14
139 0.11
140 0.11
141 0.1
142 0.1
143 0.08
144 0.08
145 0.07
146 0.03
147 0.03
148 0.02
149 0.02
150 0.02
151 0.02
152 0.02
153 0.03
154 0.03
155 0.03
156 0.03
157 0.04
158 0.05
159 0.05
160 0.06
161 0.06
162 0.06
163 0.06
164 0.07
165 0.07
166 0.06
167 0.07
168 0.07
169 0.06
170 0.07
171 0.07
172 0.07
173 0.06
174 0.06
175 0.05
176 0.04
177 0.04
178 0.03
179 0.04
180 0.04
181 0.05
182 0.05
183 0.07
184 0.08
185 0.08
186 0.09
187 0.11
188 0.12
189 0.11
190 0.11
191 0.11
192 0.11
193 0.11
194 0.11
195 0.09
196 0.12
197 0.14
198 0.16
199 0.17
200 0.19
201 0.2
202 0.21
203 0.21
204 0.19
205 0.18
206 0.17
207 0.15
208 0.12
209 0.11
210 0.09
211 0.09
212 0.06
213 0.06
214 0.05
215 0.04
216 0.04
217 0.04
218 0.04
219 0.06
220 0.08
221 0.1
222 0.12
223 0.14
224 0.17
225 0.2
226 0.24
227 0.26
228 0.29
229 0.37
230 0.46
231 0.53
232 0.61
233 0.68
234 0.73
235 0.82
236 0.88
237 0.89
238 0.9
239 0.91