Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015L817

Protein Details
Accession A0A015L817    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
46-72ARNKKHVSASWRKEKNKKTKPSVASVMHydrophilic
NLS Segment(s)
PositionSequence
49-65KKHVSASWRKEKNKKTK
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
Amino Acid Sequences MNDKYKYSKFLESLFRIQDFIPSRARRKYFDRVRTLLIQQDKAVFARNKKHVSASWRKEKNKKTKPSVASVMDIEDST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.44
3 0.39
4 0.36
5 0.37
6 0.32
7 0.3
8 0.33
9 0.34
10 0.39
11 0.45
12 0.48
13 0.46
14 0.48
15 0.56
16 0.57
17 0.61
18 0.63
19 0.58
20 0.59
21 0.58
22 0.53
23 0.47
24 0.4
25 0.32
26 0.24
27 0.23
28 0.2
29 0.17
30 0.22
31 0.19
32 0.2
33 0.27
34 0.34
35 0.37
36 0.37
37 0.4
38 0.38
39 0.45
40 0.52
41 0.52
42 0.56
43 0.62
44 0.69
45 0.75
46 0.81
47 0.83
48 0.83
49 0.85
50 0.83
51 0.84
52 0.81
53 0.8
54 0.79
55 0.71
56 0.64
57 0.54
58 0.47