Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015IYB0

Protein Details
Accession A0A015IYB0   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
61-80IQNPRVERLRPPPRDRKRFDBasic
NLS Segment(s)
PositionSequence
74-74R
76-76R
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MFLDQVITPDSAYLLEEYNKIKESLQNKQGRIPRWYNFLKNHLTISSTNNHLNIELNKPIIQNPRVERLRPPPRDRKRFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.12
4 0.14
5 0.16
6 0.17
7 0.17
8 0.17
9 0.21
10 0.25
11 0.31
12 0.39
13 0.43
14 0.43
15 0.49
16 0.53
17 0.52
18 0.53
19 0.5
20 0.42
21 0.43
22 0.46
23 0.45
24 0.43
25 0.44
26 0.42
27 0.37
28 0.36
29 0.29
30 0.27
31 0.22
32 0.22
33 0.2
34 0.19
35 0.2
36 0.19
37 0.19
38 0.17
39 0.19
40 0.18
41 0.19
42 0.17
43 0.18
44 0.18
45 0.19
46 0.23
47 0.28
48 0.28
49 0.31
50 0.33
51 0.41
52 0.44
53 0.45
54 0.47
55 0.51
56 0.59
57 0.63
58 0.68
59 0.69
60 0.77