Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A010Q0C4

Protein Details
Accession A0A010Q0C4    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
215-239TIDVACKAKSKKRSGKWRAVFSGLKHydrophilic
NLS Segment(s)
PositionSequence
223-230KSKKRSGK
Subcellular Location(s) nucl 14.5, mito_nucl 13.5, mito 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045518  2EXR  
KEGG cfj:CFIO01_05592  -  
Pfam View protein in Pfam  
PF20150  2EXR  
Amino Acid Sequences MCARRCNKSTKKSSAASEMANLKTAAKAKADNQVEAEGQAKVEAQAPSDSFHYFAKFPCEIQVMIWKEFYLEPRHFDAVIHDYRRPIKGNGNRLDREEREVSKLHLKGKEESISDYNAIDNQINYLSREIAQSIRHKVRMPRLEDTDQGLGFDIEVHNRQTSRFPDMVYFNSTIDVLHMKAPLYRMSVSFELSAWCKDIQHAVVEYTGYEDPRRTIDVACKAKSKKRSGKWRAVFSGLKSLETLYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.67
3 0.58
4 0.53
5 0.49
6 0.42
7 0.38
8 0.34
9 0.26
10 0.26
11 0.28
12 0.25
13 0.21
14 0.24
15 0.25
16 0.34
17 0.36
18 0.34
19 0.32
20 0.32
21 0.3
22 0.28
23 0.26
24 0.17
25 0.14
26 0.13
27 0.11
28 0.09
29 0.13
30 0.12
31 0.12
32 0.14
33 0.15
34 0.16
35 0.18
36 0.17
37 0.14
38 0.16
39 0.16
40 0.15
41 0.16
42 0.21
43 0.2
44 0.2
45 0.22
46 0.23
47 0.2
48 0.2
49 0.28
50 0.25
51 0.25
52 0.25
53 0.21
54 0.21
55 0.22
56 0.24
57 0.22
58 0.2
59 0.22
60 0.26
61 0.27
62 0.26
63 0.25
64 0.25
65 0.24
66 0.28
67 0.28
68 0.25
69 0.27
70 0.29
71 0.32
72 0.32
73 0.28
74 0.32
75 0.36
76 0.45
77 0.5
78 0.54
79 0.53
80 0.54
81 0.57
82 0.49
83 0.47
84 0.42
85 0.35
86 0.31
87 0.3
88 0.29
89 0.3
90 0.32
91 0.31
92 0.31
93 0.31
94 0.31
95 0.34
96 0.35
97 0.28
98 0.28
99 0.25
100 0.22
101 0.21
102 0.18
103 0.14
104 0.11
105 0.11
106 0.09
107 0.07
108 0.06
109 0.07
110 0.07
111 0.08
112 0.07
113 0.07
114 0.07
115 0.08
116 0.08
117 0.09
118 0.13
119 0.17
120 0.23
121 0.26
122 0.27
123 0.3
124 0.34
125 0.41
126 0.44
127 0.45
128 0.43
129 0.46
130 0.46
131 0.44
132 0.43
133 0.36
134 0.29
135 0.24
136 0.2
137 0.13
138 0.11
139 0.1
140 0.07
141 0.06
142 0.08
143 0.09
144 0.1
145 0.11
146 0.12
147 0.16
148 0.18
149 0.23
150 0.22
151 0.22
152 0.24
153 0.27
154 0.28
155 0.27
156 0.26
157 0.2
158 0.19
159 0.18
160 0.15
161 0.13
162 0.12
163 0.09
164 0.1
165 0.1
166 0.1
167 0.12
168 0.13
169 0.15
170 0.16
171 0.16
172 0.15
173 0.2
174 0.2
175 0.2
176 0.19
177 0.17
178 0.17
179 0.17
180 0.17
181 0.14
182 0.14
183 0.13
184 0.13
185 0.17
186 0.16
187 0.17
188 0.18
189 0.16
190 0.17
191 0.16
192 0.15
193 0.15
194 0.15
195 0.13
196 0.13
197 0.14
198 0.14
199 0.17
200 0.2
201 0.18
202 0.19
203 0.26
204 0.35
205 0.41
206 0.43
207 0.48
208 0.52
209 0.58
210 0.65
211 0.68
212 0.68
213 0.71
214 0.8
215 0.82
216 0.87
217 0.89
218 0.89
219 0.83
220 0.8
221 0.74
222 0.66
223 0.66
224 0.56
225 0.47
226 0.38