Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A010QJ19

Protein Details
Accession A0A010QJ19   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
157-176KIGGGGGGKKKKNKKNEGEEBasic
NLS Segment(s)
PositionSequence
159-172GGGGGGKKKKNKKN
Subcellular Location(s) cyto 13, cyto_nucl 10.166, cyto_mito 10.166, mito_nucl 6.666, cyto_pero 6.666, nucl 6, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR046522  DUF6699  
KEGG cfj:CFIO01_03521  -  
Pfam View protein in Pfam  
PF20415  DUF6699  
Amino Acid Sequences MTEPLTKVDSAVEGLSQSPPKESKTRRQSSAAAPGVYNIKDLEEEKIELELAPETQRTGWKINTSSSQVEDKEILKLHLSKPPVKKIDLHFPLGMEVTARNLKGVTIKDALDAIHKAYKKRSDDELDNPYLAGFEWDKEECWTRLVVHLQKNPAIEKIGGGGGGKKKKNKKNEGEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.15
3 0.16
4 0.16
5 0.19
6 0.2
7 0.24
8 0.33
9 0.39
10 0.46
11 0.55
12 0.62
13 0.63
14 0.67
15 0.67
16 0.65
17 0.68
18 0.62
19 0.52
20 0.44
21 0.41
22 0.39
23 0.33
24 0.27
25 0.17
26 0.12
27 0.13
28 0.14
29 0.15
30 0.13
31 0.14
32 0.14
33 0.14
34 0.13
35 0.11
36 0.11
37 0.09
38 0.08
39 0.08
40 0.08
41 0.08
42 0.09
43 0.11
44 0.13
45 0.16
46 0.17
47 0.21
48 0.22
49 0.24
50 0.27
51 0.28
52 0.27
53 0.26
54 0.27
55 0.23
56 0.23
57 0.22
58 0.19
59 0.18
60 0.17
61 0.15
62 0.13
63 0.15
64 0.16
65 0.18
66 0.2
67 0.24
68 0.29
69 0.36
70 0.37
71 0.36
72 0.39
73 0.38
74 0.46
75 0.42
76 0.4
77 0.33
78 0.3
79 0.29
80 0.25
81 0.21
82 0.11
83 0.08
84 0.07
85 0.09
86 0.09
87 0.08
88 0.08
89 0.08
90 0.12
91 0.13
92 0.14
93 0.14
94 0.14
95 0.15
96 0.15
97 0.15
98 0.13
99 0.13
100 0.11
101 0.14
102 0.16
103 0.17
104 0.23
105 0.3
106 0.32
107 0.35
108 0.4
109 0.41
110 0.45
111 0.5
112 0.51
113 0.46
114 0.42
115 0.38
116 0.31
117 0.25
118 0.2
119 0.15
120 0.09
121 0.07
122 0.1
123 0.11
124 0.12
125 0.15
126 0.19
127 0.17
128 0.18
129 0.19
130 0.16
131 0.21
132 0.28
133 0.33
134 0.37
135 0.42
136 0.45
137 0.46
138 0.48
139 0.45
140 0.39
141 0.34
142 0.26
143 0.21
144 0.19
145 0.17
146 0.15
147 0.14
148 0.17
149 0.23
150 0.31
151 0.37
152 0.44
153 0.54
154 0.62
155 0.72
156 0.78