Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A010RV98

Protein Details
Accession A0A010RV98   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
59-81FRGINRAFHKRRSKRYPPCDVTAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 8, extr 4, cyto_pero 4
Family & Domain DBs
KEGG cfj:CFIO01_03596  -  
Amino Acid Sequences MESSIAPAIVFLDSSWAFLNRHIRRQRPRDVTAGFQEISGTSSLGDFGRHLHCNVTAGFRGINRAFHKRRSKRYPPCDVTAAMISPEVSPPSSKGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.13
4 0.14
5 0.18
6 0.28
7 0.28
8 0.38
9 0.44
10 0.52
11 0.61
12 0.69
13 0.75
14 0.73
15 0.72
16 0.7
17 0.64
18 0.59
19 0.53
20 0.49
21 0.38
22 0.3
23 0.26
24 0.19
25 0.17
26 0.13
27 0.09
28 0.05
29 0.05
30 0.06
31 0.06
32 0.06
33 0.05
34 0.07
35 0.1
36 0.11
37 0.12
38 0.12
39 0.12
40 0.13
41 0.14
42 0.14
43 0.11
44 0.11
45 0.12
46 0.11
47 0.16
48 0.15
49 0.21
50 0.22
51 0.32
52 0.34
53 0.43
54 0.54
55 0.58
56 0.68
57 0.72
58 0.8
59 0.81
60 0.87
61 0.89
62 0.84
63 0.8
64 0.73
65 0.64
66 0.56
67 0.47
68 0.38
69 0.27
70 0.22
71 0.17
72 0.14
73 0.15
74 0.13
75 0.12
76 0.12