Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A010RTK7

Protein Details
Accession A0A010RTK7    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
14-40HDEWIHVKSKSRSRRSAPKPPVKGPGAHydrophilic
NLS Segment(s)
PositionSequence
21-48KSKSRSRRSAPKPPVKGPGAISKPAEPR
Subcellular Location(s) cyto_nucl 14, nucl 13, cyto 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR012942  SRR1-like  
KEGG cfj:CFIO01_10385  -  
Pfam View protein in Pfam  
PF07985  SRR1  
Amino Acid Sequences MATAEQLEAEKPKHDEWIHVKSKSRSRRSAPKPPVKGPGAISKPAEPRSHKSVIDITAEYHSFKSKWRETICCLSLKKLVRDNFEGHRRVRKAVCLGVGTFDPEDGGWDAKRRSYIQLDAFLTVVEVLSELYKESIPCLFQEPRFTLNDEAFLTSLGHEVVESPAAFEAVDEETIVFAVHMYRPIYEATLGKAVPAMFVGTGWNVWDEFALMKDGDFKCMSDMHASHKHFRFPQDGTYTTFSSTCVYWRPKSETVVQQETSVGEKDVSLPQEVVTVVAPETSTQIEESPQIPPGRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.37
3 0.41
4 0.5
5 0.53
6 0.55
7 0.61
8 0.61
9 0.7
10 0.72
11 0.74
12 0.73
13 0.74
14 0.8
15 0.82
16 0.85
17 0.86
18 0.87
19 0.86
20 0.82
21 0.82
22 0.74
23 0.69
24 0.61
25 0.6
26 0.55
27 0.51
28 0.47
29 0.44
30 0.47
31 0.49
32 0.52
33 0.47
34 0.48
35 0.51
36 0.55
37 0.49
38 0.46
39 0.46
40 0.42
41 0.41
42 0.35
43 0.29
44 0.27
45 0.28
46 0.25
47 0.21
48 0.2
49 0.17
50 0.22
51 0.29
52 0.31
53 0.39
54 0.43
55 0.47
56 0.5
57 0.59
58 0.57
59 0.54
60 0.5
61 0.45
62 0.46
63 0.46
64 0.46
65 0.44
66 0.46
67 0.44
68 0.47
69 0.48
70 0.49
71 0.52
72 0.52
73 0.47
74 0.52
75 0.49
76 0.5
77 0.48
78 0.45
79 0.41
80 0.4
81 0.39
82 0.32
83 0.3
84 0.26
85 0.24
86 0.2
87 0.15
88 0.12
89 0.09
90 0.07
91 0.08
92 0.07
93 0.09
94 0.07
95 0.11
96 0.12
97 0.13
98 0.16
99 0.16
100 0.19
101 0.22
102 0.26
103 0.26
104 0.31
105 0.31
106 0.29
107 0.27
108 0.23
109 0.19
110 0.14
111 0.1
112 0.04
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.04
119 0.05
120 0.05
121 0.06
122 0.07
123 0.07
124 0.08
125 0.12
126 0.14
127 0.15
128 0.19
129 0.2
130 0.22
131 0.22
132 0.23
133 0.2
134 0.18
135 0.19
136 0.15
137 0.14
138 0.11
139 0.1
140 0.09
141 0.07
142 0.08
143 0.05
144 0.05
145 0.04
146 0.04
147 0.04
148 0.05
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.04
155 0.05
156 0.05
157 0.05
158 0.05
159 0.05
160 0.04
161 0.05
162 0.05
163 0.03
164 0.03
165 0.04
166 0.04
167 0.07
168 0.07
169 0.07
170 0.09
171 0.09
172 0.1
173 0.1
174 0.11
175 0.1
176 0.13
177 0.12
178 0.11
179 0.12
180 0.12
181 0.1
182 0.1
183 0.08
184 0.05
185 0.06
186 0.06
187 0.05
188 0.05
189 0.05
190 0.06
191 0.05
192 0.05
193 0.05
194 0.05
195 0.05
196 0.06
197 0.07
198 0.06
199 0.06
200 0.14
201 0.14
202 0.17
203 0.18
204 0.17
205 0.17
206 0.18
207 0.2
208 0.17
209 0.18
210 0.22
211 0.3
212 0.33
213 0.4
214 0.42
215 0.46
216 0.45
217 0.48
218 0.47
219 0.4
220 0.45
221 0.42
222 0.42
223 0.4
224 0.41
225 0.38
226 0.33
227 0.31
228 0.24
229 0.2
230 0.18
231 0.16
232 0.2
233 0.25
234 0.28
235 0.34
236 0.41
237 0.43
238 0.47
239 0.53
240 0.53
241 0.55
242 0.58
243 0.53
244 0.46
245 0.43
246 0.4
247 0.34
248 0.26
249 0.19
250 0.12
251 0.12
252 0.14
253 0.17
254 0.18
255 0.17
256 0.16
257 0.16
258 0.18
259 0.17
260 0.16
261 0.12
262 0.11
263 0.09
264 0.1
265 0.1
266 0.08
267 0.1
268 0.1
269 0.11
270 0.1
271 0.11
272 0.12
273 0.15
274 0.16
275 0.16
276 0.2