Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A010S917

Protein Details
Accession A0A010S917   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAKGKIFKSRRRVELRKEIEEKBasic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
KEGG cfj:CFIO01_07195  -  
Amino Acid Sequences MAKGKIFKSRRRVELRKEIEEKQHEYYDAAPSSSQQSQGSIGGTNEDSGVPGPHQLVWPFSYAVFQAHAASQSDGGARLLEDARWKCCNCGYYNAMPAHGLRLMHCRNPEGCVVNPGTLQVHAGPASCCAIVGPEGAWTSMDVLDLRFRSEEAMMGARGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.83
4 0.79
5 0.74
6 0.73
7 0.71
8 0.65
9 0.59
10 0.53
11 0.44
12 0.4
13 0.37
14 0.34
15 0.28
16 0.24
17 0.19
18 0.17
19 0.21
20 0.22
21 0.22
22 0.16
23 0.16
24 0.17
25 0.18
26 0.18
27 0.14
28 0.13
29 0.12
30 0.12
31 0.11
32 0.1
33 0.09
34 0.08
35 0.07
36 0.08
37 0.06
38 0.07
39 0.08
40 0.08
41 0.09
42 0.1
43 0.11
44 0.11
45 0.13
46 0.12
47 0.11
48 0.11
49 0.1
50 0.1
51 0.09
52 0.09
53 0.08
54 0.08
55 0.09
56 0.09
57 0.09
58 0.08
59 0.08
60 0.07
61 0.07
62 0.07
63 0.06
64 0.05
65 0.06
66 0.06
67 0.06
68 0.11
69 0.12
70 0.15
71 0.19
72 0.19
73 0.19
74 0.21
75 0.24
76 0.2
77 0.25
78 0.26
79 0.25
80 0.31
81 0.31
82 0.29
83 0.26
84 0.24
85 0.2
86 0.17
87 0.15
88 0.1
89 0.17
90 0.19
91 0.22
92 0.24
93 0.25
94 0.24
95 0.26
96 0.28
97 0.24
98 0.22
99 0.23
100 0.23
101 0.21
102 0.2
103 0.19
104 0.17
105 0.13
106 0.13
107 0.09
108 0.1
109 0.09
110 0.1
111 0.1
112 0.1
113 0.12
114 0.11
115 0.1
116 0.08
117 0.09
118 0.08
119 0.09
120 0.07
121 0.08
122 0.09
123 0.09
124 0.1
125 0.09
126 0.1
127 0.1
128 0.1
129 0.08
130 0.09
131 0.15
132 0.15
133 0.16
134 0.15
135 0.15
136 0.17
137 0.17
138 0.17
139 0.15
140 0.18