Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A010R057

Protein Details
Accession A0A010R057    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
43-73LDGFHGRQPKVKRKERRAKRVRNKSDPAVTVBasic
NLS Segment(s)
PositionSequence
49-66RQPKVKRKERRAKRVRNK
Subcellular Location(s) cyto_nucl 12.833, nucl 12, cyto 10.5, mito_nucl 7.999
Family & Domain DBs
KEGG cfj:CFIO01_12206  -  
Amino Acid Sequences MLAVGRLDTYFHIEIKQADKAGFGLTPLTTPLTGIRRVTTPTLDGFHGRQPKVKRKERRAKRVRNKSDPAVTVTDKQAPHPPPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.25
4 0.2
5 0.19
6 0.19
7 0.18
8 0.17
9 0.15
10 0.11
11 0.09
12 0.08
13 0.08
14 0.08
15 0.09
16 0.07
17 0.08
18 0.11
19 0.13
20 0.15
21 0.15
22 0.15
23 0.15
24 0.17
25 0.18
26 0.16
27 0.14
28 0.13
29 0.14
30 0.14
31 0.14
32 0.14
33 0.18
34 0.23
35 0.23
36 0.27
37 0.33
38 0.43
39 0.52
40 0.6
41 0.65
42 0.7
43 0.81
44 0.86
45 0.9
46 0.91
47 0.92
48 0.94
49 0.95
50 0.94
51 0.93
52 0.89
53 0.86
54 0.83
55 0.74
56 0.67
57 0.61
58 0.53
59 0.47
60 0.43
61 0.41
62 0.34
63 0.35
64 0.39