Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A010RVD9

Protein Details
Accession A0A010RVD9   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
176-198VSHRSAKKARDRRDPKSSKREVSBasic
NLS Segment(s)
PositionSequence
179-194RSAKKARDRRDPKSSK
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR041661  ZN622/Rei1/Reh1_Znf-C2H2  
IPR040025  Znf622/Rei1/Reh1  
IPR036236  Znf_C2H2_sf  
KEGG cfj:CFIO01_06615  -  
Pfam View protein in Pfam  
PF12756  zf-C2H2_2  
Amino Acid Sequences MSELSVPRSDPVAELEDPNELSECLQEASLPDSDEDENDTEPQEIFNPSQCLFCSELSPAFAESMVHMQKRHGLSLPNPESLIVDLETLIKYFHLVMVEYKECLYCGSVRNTAQAVRQHMTGKSHCRIDIDKPDSEFRDFYNLDPGNGRGSEDSLGCRHFVDSNENTRELASGKIVSHRSAKKARDRRDPKSSKREVSDSLLVGEGSSKGNTSTALTASHHIEKGLTTAADNRERMFEKQLATLRPADRQALTHLPLPQQRALVAKAKKQQEAWNSEQTAQMIKVQIKAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.21
4 0.21
5 0.21
6 0.18
7 0.13
8 0.12
9 0.11
10 0.12
11 0.1
12 0.09
13 0.09
14 0.09
15 0.12
16 0.13
17 0.13
18 0.12
19 0.14
20 0.14
21 0.15
22 0.16
23 0.15
24 0.15
25 0.15
26 0.15
27 0.14
28 0.13
29 0.13
30 0.12
31 0.13
32 0.13
33 0.17
34 0.2
35 0.19
36 0.21
37 0.21
38 0.22
39 0.22
40 0.22
41 0.19
42 0.18
43 0.19
44 0.18
45 0.19
46 0.16
47 0.13
48 0.13
49 0.11
50 0.1
51 0.15
52 0.17
53 0.18
54 0.18
55 0.18
56 0.24
57 0.26
58 0.27
59 0.23
60 0.24
61 0.26
62 0.37
63 0.4
64 0.35
65 0.33
66 0.31
67 0.29
68 0.26
69 0.23
70 0.12
71 0.09
72 0.07
73 0.09
74 0.08
75 0.08
76 0.07
77 0.06
78 0.06
79 0.06
80 0.07
81 0.06
82 0.07
83 0.08
84 0.13
85 0.14
86 0.14
87 0.14
88 0.13
89 0.12
90 0.12
91 0.12
92 0.09
93 0.13
94 0.16
95 0.2
96 0.21
97 0.23
98 0.23
99 0.23
100 0.25
101 0.26
102 0.26
103 0.23
104 0.25
105 0.25
106 0.26
107 0.29
108 0.29
109 0.31
110 0.3
111 0.31
112 0.29
113 0.3
114 0.3
115 0.32
116 0.37
117 0.35
118 0.33
119 0.33
120 0.35
121 0.34
122 0.34
123 0.28
124 0.19
125 0.21
126 0.2
127 0.18
128 0.25
129 0.23
130 0.22
131 0.22
132 0.22
133 0.17
134 0.17
135 0.17
136 0.08
137 0.08
138 0.09
139 0.09
140 0.1
141 0.09
142 0.1
143 0.1
144 0.1
145 0.1
146 0.1
147 0.11
148 0.17
149 0.19
150 0.26
151 0.28
152 0.28
153 0.27
154 0.25
155 0.25
156 0.19
157 0.16
158 0.1
159 0.09
160 0.09
161 0.14
162 0.16
163 0.17
164 0.23
165 0.26
166 0.31
167 0.37
168 0.43
169 0.48
170 0.57
171 0.63
172 0.67
173 0.73
174 0.74
175 0.78
176 0.81
177 0.8
178 0.82
179 0.81
180 0.76
181 0.72
182 0.68
183 0.6
184 0.56
185 0.51
186 0.4
187 0.33
188 0.28
189 0.23
190 0.19
191 0.16
192 0.11
193 0.08
194 0.08
195 0.07
196 0.07
197 0.07
198 0.08
199 0.09
200 0.1
201 0.1
202 0.11
203 0.12
204 0.14
205 0.18
206 0.2
207 0.19
208 0.18
209 0.17
210 0.15
211 0.16
212 0.15
213 0.12
214 0.09
215 0.14
216 0.2
217 0.25
218 0.26
219 0.25
220 0.28
221 0.31
222 0.32
223 0.33
224 0.31
225 0.27
226 0.33
227 0.37
228 0.35
229 0.35
230 0.39
231 0.36
232 0.37
233 0.37
234 0.34
235 0.3
236 0.29
237 0.32
238 0.31
239 0.32
240 0.32
241 0.33
242 0.36
243 0.38
244 0.41
245 0.38
246 0.33
247 0.32
248 0.31
249 0.32
250 0.34
251 0.36
252 0.39
253 0.44
254 0.5
255 0.53
256 0.54
257 0.58
258 0.59
259 0.62
260 0.61
261 0.62
262 0.58
263 0.55
264 0.53
265 0.46
266 0.41
267 0.33
268 0.31
269 0.27
270 0.26