Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E1RXS3

Protein Details
Accession A0A0E1RXS3    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
117-141GMVGLKKRDRSAKKKGKAKGKVAKGBasic
NLS Segment(s)
PositionSequence
122-141KKRDRSAKKKGKAKGKVAKG
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG cim:CIMG_05589  -  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MTAHLSQDEFFTHLTALLTNQSTSLRGSVFLTQKLLPAPPPDRSTTTTTTQTTASAEAPSSAERTTTTTTFQPNQSAVLIRASNGRHKTAKVKASTIVQPEELEAFYARYAELCKAGMVGLKKRDRSAKKKGKAKGKVAKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.1
4 0.12
5 0.13
6 0.12
7 0.13
8 0.13
9 0.13
10 0.14
11 0.14
12 0.11
13 0.11
14 0.13
15 0.18
16 0.21
17 0.21
18 0.23
19 0.21
20 0.23
21 0.23
22 0.22
23 0.18
24 0.21
25 0.23
26 0.25
27 0.28
28 0.3
29 0.32
30 0.35
31 0.38
32 0.36
33 0.37
34 0.37
35 0.35
36 0.33
37 0.29
38 0.26
39 0.22
40 0.19
41 0.16
42 0.11
43 0.1
44 0.09
45 0.09
46 0.09
47 0.09
48 0.08
49 0.07
50 0.07
51 0.1
52 0.12
53 0.12
54 0.14
55 0.14
56 0.17
57 0.19
58 0.2
59 0.19
60 0.17
61 0.17
62 0.16
63 0.15
64 0.12
65 0.13
66 0.12
67 0.1
68 0.14
69 0.14
70 0.21
71 0.22
72 0.25
73 0.24
74 0.27
75 0.33
76 0.37
77 0.42
78 0.38
79 0.38
80 0.37
81 0.39
82 0.41
83 0.38
84 0.32
85 0.27
86 0.24
87 0.22
88 0.21
89 0.16
90 0.13
91 0.1
92 0.09
93 0.08
94 0.08
95 0.07
96 0.07
97 0.09
98 0.09
99 0.1
100 0.1
101 0.1
102 0.1
103 0.1
104 0.13
105 0.16
106 0.21
107 0.29
108 0.35
109 0.38
110 0.43
111 0.53
112 0.59
113 0.64
114 0.69
115 0.71
116 0.74
117 0.8
118 0.84
119 0.85
120 0.85
121 0.87