Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A010S062

Protein Details
Accession A0A010S062    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
156-187EWTQKKVSSLKSKTSRKHTKEYSKARARYPSPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019371  KxDL_dom  
Gene Ontology GO:0005768  C:endosome  
KEGG cfj:CFIO01_08443  -  
Pfam View protein in Pfam  
PF10241  KxDL  
Amino Acid Sequences MSSHYNSHYTLPLPVPSHKGQHYPSYSSTYSVSPPETDESVSSGTGPSYSNSGYSGGYSVANSSYAGSNSGDYESTHHSASGVDFNDYMQDRFAQTFDPIPLDRNIAVQAQTSGKLNAKHRELLELQKKAQARLAKTRERFNEGYRDAQDVRADLEWTQKKVSSLKSKTSRKHTKEYSKARARYPSPEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.34
3 0.35
4 0.4
5 0.38
6 0.42
7 0.4
8 0.46
9 0.48
10 0.46
11 0.46
12 0.46
13 0.44
14 0.39
15 0.38
16 0.3
17 0.27
18 0.25
19 0.24
20 0.18
21 0.2
22 0.21
23 0.2
24 0.19
25 0.17
26 0.17
27 0.16
28 0.16
29 0.13
30 0.11
31 0.1
32 0.1
33 0.1
34 0.08
35 0.09
36 0.09
37 0.09
38 0.1
39 0.11
40 0.1
41 0.1
42 0.1
43 0.09
44 0.09
45 0.08
46 0.08
47 0.07
48 0.08
49 0.07
50 0.07
51 0.08
52 0.07
53 0.09
54 0.08
55 0.09
56 0.09
57 0.09
58 0.09
59 0.08
60 0.1
61 0.13
62 0.14
63 0.14
64 0.13
65 0.12
66 0.12
67 0.13
68 0.15
69 0.11
70 0.1
71 0.1
72 0.1
73 0.12
74 0.13
75 0.12
76 0.08
77 0.08
78 0.09
79 0.09
80 0.09
81 0.07
82 0.07
83 0.08
84 0.09
85 0.1
86 0.1
87 0.11
88 0.12
89 0.12
90 0.12
91 0.11
92 0.12
93 0.11
94 0.11
95 0.09
96 0.1
97 0.1
98 0.1
99 0.1
100 0.11
101 0.13
102 0.18
103 0.22
104 0.27
105 0.29
106 0.32
107 0.32
108 0.35
109 0.34
110 0.39
111 0.42
112 0.4
113 0.38
114 0.38
115 0.39
116 0.35
117 0.38
118 0.33
119 0.29
120 0.36
121 0.43
122 0.48
123 0.51
124 0.58
125 0.57
126 0.6
127 0.58
128 0.51
129 0.53
130 0.47
131 0.49
132 0.43
133 0.43
134 0.37
135 0.36
136 0.34
137 0.24
138 0.24
139 0.19
140 0.18
141 0.14
142 0.23
143 0.25
144 0.26
145 0.28
146 0.28
147 0.29
148 0.33
149 0.42
150 0.43
151 0.44
152 0.52
153 0.61
154 0.68
155 0.74
156 0.8
157 0.82
158 0.78
159 0.83
160 0.84
161 0.84
162 0.86
163 0.88
164 0.88
165 0.87
166 0.86
167 0.82
168 0.81
169 0.74