Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D8JTQ2

Protein Details
Accession A0A0D8JTQ2    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
82-113KRLCDGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 8, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cim:CIMG_12241  -  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MIRSFFSSASAQSLRQLHSTLSNRTCPSAFSRSIWHLSTSAARIWSPLSKLASNAERTLRYGPGSQNVLGQVRGMKTRSSVKRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.27
4 0.22
5 0.29
6 0.34
7 0.36
8 0.37
9 0.41
10 0.4
11 0.41
12 0.4
13 0.33
14 0.34
15 0.33
16 0.3
17 0.26
18 0.3
19 0.31
20 0.35
21 0.34
22 0.29
23 0.23
24 0.23
25 0.24
26 0.2
27 0.17
28 0.15
29 0.14
30 0.13
31 0.14
32 0.14
33 0.13
34 0.15
35 0.16
36 0.15
37 0.16
38 0.19
39 0.21
40 0.21
41 0.21
42 0.2
43 0.18
44 0.2
45 0.21
46 0.18
47 0.16
48 0.17
49 0.16
50 0.18
51 0.2
52 0.18
53 0.18
54 0.18
55 0.18
56 0.15
57 0.15
58 0.13
59 0.12
60 0.14
61 0.14
62 0.13
63 0.15
64 0.25
65 0.3
66 0.36
67 0.39
68 0.4
69 0.48
70 0.51
71 0.51
72 0.5
73 0.52
74 0.54
75 0.6
76 0.65
77 0.66
78 0.73
79 0.78
80 0.77
81 0.79
82 0.8
83 0.79
84 0.78
85 0.78
86 0.76
87 0.77
88 0.79
89 0.75
90 0.75
91 0.77
92 0.81
93 0.82