Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A010QY57

Protein Details
Accession A0A010QY57   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-32CEPVGDARRSERRRNKSKGGILGEHydrophilic
NLS Segment(s)
PositionSequence
20-24RRRNK
Subcellular Location(s) mito 15, cyto_nucl 6.5, cyto 6, nucl 5
Family & Domain DBs
KEGG cfj:CFIO01_09355  -  
Amino Acid Sequences MDTASLRICEPVGDARRSERRRNKSKGGILGEECAGDGPCPSPFRLARDRVDWDSHCEPARPSPHRLHPTDIRQGLDGPGKPRHRWAAGILGQGSRLAQAFPISMPHCITSIQRARRDHPKGCGTPRWLLSAIMWEQASSIVASVRTRTASLTIATRAEHAIAFNHDMDVNQLYERLCGSLAAKGPTNATPTKDVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.35
3 0.45
4 0.52
5 0.6
6 0.62
7 0.66
8 0.74
9 0.81
10 0.83
11 0.83
12 0.84
13 0.82
14 0.78
15 0.73
16 0.64
17 0.58
18 0.48
19 0.38
20 0.3
21 0.22
22 0.16
23 0.1
24 0.08
25 0.07
26 0.1
27 0.12
28 0.12
29 0.18
30 0.19
31 0.26
32 0.34
33 0.38
34 0.39
35 0.42
36 0.47
37 0.45
38 0.49
39 0.43
40 0.43
41 0.39
42 0.39
43 0.35
44 0.3
45 0.28
46 0.29
47 0.37
48 0.33
49 0.36
50 0.4
51 0.49
52 0.54
53 0.55
54 0.55
55 0.53
56 0.56
57 0.59
58 0.54
59 0.46
60 0.39
61 0.37
62 0.34
63 0.3
64 0.26
65 0.21
66 0.26
67 0.29
68 0.29
69 0.32
70 0.34
71 0.31
72 0.3
73 0.29
74 0.3
75 0.29
76 0.31
77 0.28
78 0.23
79 0.22
80 0.2
81 0.18
82 0.1
83 0.07
84 0.05
85 0.04
86 0.04
87 0.05
88 0.05
89 0.08
90 0.08
91 0.09
92 0.1
93 0.1
94 0.1
95 0.11
96 0.11
97 0.16
98 0.23
99 0.28
100 0.34
101 0.36
102 0.4
103 0.49
104 0.56
105 0.52
106 0.52
107 0.54
108 0.53
109 0.56
110 0.58
111 0.52
112 0.51
113 0.48
114 0.44
115 0.37
116 0.32
117 0.27
118 0.26
119 0.22
120 0.19
121 0.17
122 0.13
123 0.12
124 0.12
125 0.12
126 0.07
127 0.07
128 0.05
129 0.07
130 0.07
131 0.08
132 0.1
133 0.1
134 0.11
135 0.11
136 0.12
137 0.13
138 0.14
139 0.16
140 0.16
141 0.17
142 0.17
143 0.17
144 0.16
145 0.15
146 0.14
147 0.11
148 0.11
149 0.13
150 0.15
151 0.14
152 0.15
153 0.14
154 0.14
155 0.15
156 0.15
157 0.13
158 0.11
159 0.13
160 0.12
161 0.12
162 0.13
163 0.12
164 0.1
165 0.1
166 0.11
167 0.14
168 0.17
169 0.19
170 0.21
171 0.21
172 0.24
173 0.25
174 0.29
175 0.27
176 0.27