Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A010Q994

Protein Details
Accession A0A010Q994   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKSSSKPQGPKKREVLPSKBasic
NLS Segment(s)
PositionSequence
4-15RKSSSKPQGPKK
Subcellular Location(s) mito 15, cyto 10.5, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
KEGG cfj:CFIO01_06903  -  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSSSKPQGPKKREVLPSKFTCLFCNHEDSVAVKLDKKAGVGSLDCRVCGQMFQCSINYLSAAVDVYGEWVDAADAVAKEAGPVGGSNHKTSSARRAPPSRPVDDDDDDRRYGGEGIDMDDDEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.82
3 0.81
4 0.8
5 0.77
6 0.75
7 0.73
8 0.71
9 0.69
10 0.61
11 0.54
12 0.48
13 0.45
14 0.38
15 0.39
16 0.32
17 0.27
18 0.27
19 0.25
20 0.24
21 0.22
22 0.2
23 0.16
24 0.16
25 0.19
26 0.18
27 0.18
28 0.15
29 0.13
30 0.14
31 0.13
32 0.15
33 0.18
34 0.17
35 0.17
36 0.17
37 0.16
38 0.14
39 0.14
40 0.13
41 0.11
42 0.12
43 0.13
44 0.13
45 0.14
46 0.14
47 0.14
48 0.13
49 0.08
50 0.07
51 0.06
52 0.06
53 0.05
54 0.04
55 0.03
56 0.04
57 0.04
58 0.04
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.04
65 0.04
66 0.04
67 0.05
68 0.04
69 0.05
70 0.05
71 0.05
72 0.04
73 0.04
74 0.06
75 0.13
76 0.15
77 0.16
78 0.17
79 0.2
80 0.21
81 0.23
82 0.31
83 0.33
84 0.38
85 0.45
86 0.51
87 0.53
88 0.61
89 0.67
90 0.61
91 0.56
92 0.54
93 0.53
94 0.5
95 0.52
96 0.47
97 0.45
98 0.4
99 0.36
100 0.32
101 0.27
102 0.24
103 0.18
104 0.16
105 0.12
106 0.14
107 0.16