Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A010QXE5

Protein Details
Accession A0A010QXE5   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
60-83SKNEPKKGEPEKKSESKKKAETDDBasic
NLS Segment(s)
PositionSequence
62-78NEPKKGEPEKKSESKKK
Subcellular Location(s) nucl 11, mito 10, cyto 3, pero 1, golg 1, cysk 1
Family & Domain DBs
KEGG cfj:CFIO01_07790  -  
Amino Acid Sequences MPSSKGKPTDPELREEIKEEIKQEPNKSGGGEGQWAAWKGAKLAKEYEKQGGGYENEAGSKNEPKKGEPEKKSESKKKAETDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.43
3 0.4
4 0.35
5 0.35
6 0.31
7 0.32
8 0.35
9 0.39
10 0.39
11 0.39
12 0.36
13 0.35
14 0.33
15 0.28
16 0.21
17 0.17
18 0.16
19 0.13
20 0.11
21 0.12
22 0.12
23 0.11
24 0.11
25 0.1
26 0.1
27 0.12
28 0.13
29 0.13
30 0.16
31 0.22
32 0.24
33 0.26
34 0.28
35 0.27
36 0.25
37 0.25
38 0.24
39 0.19
40 0.17
41 0.16
42 0.13
43 0.13
44 0.14
45 0.14
46 0.14
47 0.21
48 0.23
49 0.27
50 0.28
51 0.29
52 0.37
53 0.47
54 0.55
55 0.53
56 0.58
57 0.62
58 0.7
59 0.79
60 0.81
61 0.79
62 0.78
63 0.81