Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A010RWC2

Protein Details
Accession A0A010RWC2    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-29IPAALKPKPKRAAPKPQQTSYTSHydrophilic
NLS Segment(s)
PositionSequence
13-18PKPKRA
Subcellular Location(s) mito 13.5, cyto_mito 12, cyto 9.5, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045054  P4HA-like  
IPR006620  Pro_4_hyd_alph  
Gene Ontology GO:0051213  F:dioxygenase activity  
GO:0005506  F:iron ion binding  
GO:0031418  F:L-ascorbic acid binding  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
KEGG cfj:CFIO01_02402  -  
Amino Acid Sequences MPISDLIPAALKPKPKRAAPKPQQTSYTSNEVPIPPDFLSVPLPASAPTVTLQKLDWSKTVLPENGPLYAVVLDNVLTPAECAQLLRMAEASATDRGPDPDKDEPWRPAMVNMGPGWEILEPEYRNSDRIIWDQQEVVDRLWGRSHCDGPYGEEAEDGTVFRTHYTVHLYLNDSVAEAGKDSGADLVGGATSFLSGDEKRKVDVDPKAGRVLIFQHSRLYHSGDDVVKGTKYTMRTDILYELIKTKIEDEADGDEAAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.51
3 0.62
4 0.68
5 0.77
6 0.79
7 0.85
8 0.84
9 0.83
10 0.81
11 0.75
12 0.7
13 0.64
14 0.62
15 0.51
16 0.44
17 0.41
18 0.36
19 0.34
20 0.29
21 0.28
22 0.19
23 0.2
24 0.19
25 0.17
26 0.18
27 0.16
28 0.16
29 0.13
30 0.13
31 0.12
32 0.13
33 0.11
34 0.1
35 0.11
36 0.13
37 0.13
38 0.14
39 0.14
40 0.18
41 0.21
42 0.22
43 0.23
44 0.24
45 0.25
46 0.28
47 0.33
48 0.29
49 0.27
50 0.29
51 0.29
52 0.25
53 0.24
54 0.19
55 0.15
56 0.14
57 0.13
58 0.08
59 0.07
60 0.06
61 0.06
62 0.06
63 0.05
64 0.04
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.09
72 0.09
73 0.09
74 0.09
75 0.08
76 0.08
77 0.09
78 0.1
79 0.08
80 0.08
81 0.08
82 0.09
83 0.11
84 0.14
85 0.14
86 0.16
87 0.19
88 0.22
89 0.26
90 0.29
91 0.3
92 0.3
93 0.31
94 0.26
95 0.23
96 0.24
97 0.2
98 0.18
99 0.16
100 0.14
101 0.12
102 0.12
103 0.12
104 0.09
105 0.08
106 0.06
107 0.1
108 0.09
109 0.1
110 0.14
111 0.13
112 0.14
113 0.15
114 0.15
115 0.13
116 0.16
117 0.19
118 0.16
119 0.17
120 0.16
121 0.16
122 0.18
123 0.17
124 0.14
125 0.13
126 0.12
127 0.12
128 0.15
129 0.14
130 0.16
131 0.17
132 0.19
133 0.17
134 0.19
135 0.19
136 0.19
137 0.22
138 0.2
139 0.17
140 0.15
141 0.15
142 0.13
143 0.13
144 0.09
145 0.07
146 0.06
147 0.06
148 0.06
149 0.07
150 0.07
151 0.08
152 0.13
153 0.13
154 0.14
155 0.16
156 0.19
157 0.19
158 0.2
159 0.18
160 0.13
161 0.12
162 0.11
163 0.09
164 0.06
165 0.06
166 0.05
167 0.05
168 0.05
169 0.05
170 0.05
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.04
177 0.03
178 0.03
179 0.03
180 0.03
181 0.06
182 0.07
183 0.11
184 0.17
185 0.18
186 0.19
187 0.21
188 0.22
189 0.27
190 0.32
191 0.38
192 0.38
193 0.4
194 0.42
195 0.41
196 0.4
197 0.34
198 0.31
199 0.3
200 0.28
201 0.26
202 0.28
203 0.29
204 0.32
205 0.32
206 0.33
207 0.26
208 0.24
209 0.28
210 0.23
211 0.24
212 0.23
213 0.23
214 0.2
215 0.19
216 0.19
217 0.18
218 0.19
219 0.22
220 0.25
221 0.25
222 0.26
223 0.28
224 0.29
225 0.29
226 0.29
227 0.26
228 0.23
229 0.22
230 0.22
231 0.2
232 0.19
233 0.19
234 0.18
235 0.18
236 0.18
237 0.21
238 0.21
239 0.21