Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A010QBJ2

Protein Details
Accession A0A010QBJ2    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
91-118GEETAPKKEKKDKKDKKEKSKKRKSTSGBasic
NLS Segment(s)
PositionSequence
96-116PKKEKKDKKDKKEKSKKRKST
Subcellular Location(s) nucl 18.5, cyto_nucl 13.833, mito_nucl 10.666, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR028217  Rsa3_C  
Gene Ontology GO:0005730  C:nucleolus  
KEGG cfj:CFIO01_04052  -  
Pfam View protein in Pfam  
PF14615  Rsa3  
Amino Acid Sequences MATTTTQDFTAYYLQRTTQEFAEDLDKVRAADDFKAESLPFLIHALQQGTALYSVRDQERVVKPPSAAAAAPAAVAVAVDEDVDMAEAADGEETAPKKEKKDKKDKKEKSKKRKSTSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.28
4 0.28
5 0.22
6 0.22
7 0.21
8 0.21
9 0.23
10 0.2
11 0.18
12 0.18
13 0.17
14 0.15
15 0.15
16 0.15
17 0.13
18 0.14
19 0.14
20 0.14
21 0.14
22 0.15
23 0.15
24 0.13
25 0.12
26 0.11
27 0.09
28 0.08
29 0.08
30 0.07
31 0.08
32 0.09
33 0.08
34 0.08
35 0.08
36 0.07
37 0.07
38 0.07
39 0.06
40 0.06
41 0.07
42 0.08
43 0.09
44 0.09
45 0.16
46 0.19
47 0.24
48 0.25
49 0.25
50 0.24
51 0.24
52 0.25
53 0.19
54 0.15
55 0.11
56 0.09
57 0.08
58 0.08
59 0.06
60 0.05
61 0.04
62 0.04
63 0.03
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.07
80 0.07
81 0.1
82 0.17
83 0.19
84 0.25
85 0.35
86 0.44
87 0.52
88 0.63
89 0.72
90 0.77
91 0.86
92 0.92
93 0.93
94 0.96
95 0.96
96 0.96
97 0.97
98 0.96