Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A010Q991

Protein Details
Accession A0A010Q991   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
42-76GGMAKKRKKKVYTTPKKIKHKRKKTKLAVLKYYKVBasic
NLS Segment(s)
PositionSequence
41-67RGGMAKKRKKKVYTTPKKIKHKRKKTK
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002906  Ribosomal_S27a  
IPR011332  Ribosomal_zn-bd  
IPR038582  S27a-like_sf  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cfj:CFIO01_05620  -  
Pfam View protein in Pfam  
PF01599  Ribosomal_S27  
PF00240  ubiquitin  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
Amino Acid Sequences EGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMAKKRKKKVYTTPKKIKHKRKKTKLAVLKYYKVDSDGKIERLRRECPSDTCGAGVFMAAMNDRQYCGRCHLTYVFDKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.29
3 0.3
4 0.27
5 0.24
6 0.23
7 0.22
8 0.19
9 0.19
10 0.15
11 0.21
12 0.23
13 0.24
14 0.27
15 0.24
16 0.23
17 0.23
18 0.26
19 0.22
20 0.2
21 0.17
22 0.18
23 0.21
24 0.21
25 0.21
26 0.19
27 0.15
28 0.16
29 0.19
30 0.23
31 0.31
32 0.4
33 0.48
34 0.56
35 0.64
36 0.66
37 0.72
38 0.75
39 0.76
40 0.78
41 0.8
42 0.82
43 0.84
44 0.89
45 0.91
46 0.91
47 0.91
48 0.91
49 0.91
50 0.92
51 0.93
52 0.91
53 0.92
54 0.9
55 0.87
56 0.85
57 0.8
58 0.74
59 0.65
60 0.57
61 0.47
62 0.4
63 0.34
64 0.25
65 0.25
66 0.24
67 0.26
68 0.3
69 0.33
70 0.37
71 0.39
72 0.42
73 0.4
74 0.43
75 0.43
76 0.42
77 0.43
78 0.4
79 0.36
80 0.32
81 0.28
82 0.22
83 0.18
84 0.14
85 0.09
86 0.07
87 0.07
88 0.06
89 0.07
90 0.08
91 0.09
92 0.1
93 0.12
94 0.13
95 0.16
96 0.22
97 0.28
98 0.27
99 0.31
100 0.34
101 0.38
102 0.46