Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A010RY67

Protein Details
Accession A0A010RY67    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPQGKKKKTPRASKPPNVPKGPKPKEBasic
NLS Segment(s)
PositionSequence
4-25GKKKKTPRASKPPNVPKGPKPK
Subcellular Location(s) nucl 22, mito 4
Family & Domain DBs
KEGG cfj:CFIO01_04033  -  
Amino Acid Sequences MPQGKKKKTPRASKPPNVPKGPKPKELQEEMNEEAYERILLRYGEDHDFVRRARITLDKKKNKGSQSNDPQGGQSSKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.91
3 0.91
4 0.88
5 0.83
6 0.8
7 0.81
8 0.77
9 0.74
10 0.67
11 0.65
12 0.64
13 0.63
14 0.6
15 0.52
16 0.51
17 0.45
18 0.42
19 0.34
20 0.27
21 0.22
22 0.16
23 0.13
24 0.08
25 0.06
26 0.06
27 0.06
28 0.06
29 0.07
30 0.1
31 0.11
32 0.12
33 0.13
34 0.14
35 0.16
36 0.16
37 0.19
38 0.17
39 0.16
40 0.17
41 0.26
42 0.33
43 0.42
44 0.53
45 0.58
46 0.63
47 0.72
48 0.77
49 0.76
50 0.77
51 0.74
52 0.74
53 0.75
54 0.79
55 0.74
56 0.67
57 0.6
58 0.56