Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D8JVX9

Protein Details
Accession A0A0D8JVX9    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
8-37AWRRVSRRTGAGPKRRWSSRRPAFEPPKSAHydrophilic
NLS Segment(s)
PositionSequence
11-30RVSRRTGAGPKRRWSSRRPA
Subcellular Location(s) mito 10, nucl 8, cyto_mito 8
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG cim:CIMG_13552  -  
Amino Acid Sequences MRDDRVFAWRRVSRRTGAGPKRRWSSRRPAFEPPKSAPSQVNVLHAYLTWLSWGAKPSGHETSSAAAGLDGDYQSLGIPSGSWTKRHSRRGMRFVLLTRITSEHRIRHPSERRRYAITLPSCLSTCACAFVSSALVSSYLHFFFPLDSPPMSAILSVSCPAPCVTNPGIRKSFPIPPFGLDPGVLLPGKVVFLVLENESGLSLSGISSELVANPAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.6
3 0.61
4 0.66
5 0.72
6 0.73
7 0.76
8 0.8
9 0.82
10 0.77
11 0.74
12 0.75
13 0.75
14 0.77
15 0.74
16 0.76
17 0.77
18 0.8
19 0.8
20 0.73
21 0.71
22 0.63
23 0.6
24 0.51
25 0.43
26 0.42
27 0.37
28 0.37
29 0.3
30 0.28
31 0.25
32 0.23
33 0.22
34 0.15
35 0.13
36 0.08
37 0.08
38 0.09
39 0.11
40 0.13
41 0.11
42 0.13
43 0.14
44 0.19
45 0.22
46 0.22
47 0.21
48 0.2
49 0.21
50 0.2
51 0.18
52 0.13
53 0.08
54 0.08
55 0.07
56 0.07
57 0.06
58 0.05
59 0.04
60 0.05
61 0.05
62 0.05
63 0.04
64 0.03
65 0.03
66 0.05
67 0.13
68 0.14
69 0.16
70 0.19
71 0.28
72 0.37
73 0.45
74 0.53
75 0.56
76 0.64
77 0.7
78 0.72
79 0.65
80 0.59
81 0.52
82 0.5
83 0.41
84 0.32
85 0.25
86 0.22
87 0.21
88 0.23
89 0.25
90 0.23
91 0.26
92 0.3
93 0.32
94 0.39
95 0.48
96 0.53
97 0.59
98 0.62
99 0.61
100 0.6
101 0.6
102 0.54
103 0.52
104 0.44
105 0.38
106 0.31
107 0.3
108 0.26
109 0.24
110 0.2
111 0.14
112 0.12
113 0.11
114 0.1
115 0.09
116 0.09
117 0.09
118 0.1
119 0.08
120 0.08
121 0.06
122 0.06
123 0.06
124 0.07
125 0.08
126 0.08
127 0.08
128 0.08
129 0.08
130 0.08
131 0.09
132 0.11
133 0.11
134 0.11
135 0.12
136 0.12
137 0.13
138 0.12
139 0.11
140 0.09
141 0.07
142 0.08
143 0.08
144 0.08
145 0.07
146 0.08
147 0.08
148 0.1
149 0.09
150 0.15
151 0.17
152 0.24
153 0.27
154 0.33
155 0.36
156 0.35
157 0.39
158 0.37
159 0.43
160 0.37
161 0.41
162 0.35
163 0.34
164 0.37
165 0.35
166 0.31
167 0.22
168 0.21
169 0.16
170 0.18
171 0.15
172 0.11
173 0.1
174 0.09
175 0.1
176 0.09
177 0.08
178 0.05
179 0.07
180 0.09
181 0.1
182 0.1
183 0.1
184 0.1
185 0.1
186 0.1
187 0.09
188 0.06
189 0.05
190 0.05
191 0.05
192 0.06
193 0.06
194 0.06
195 0.06
196 0.07