Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q1E554

Protein Details
Accession Q1E554    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
102-130RYEKMAEKMHRKRVERRKRREKRNKLLNSBasic
NLS Segment(s)
PositionSequence
30-37KGMRKNGK
56-126ARRLEERKAMAAIKEKEKEMKEEKEAERQRRIQAIKDRRAAKEEKERYEKMAEKMHRKRVERRKRREKRNK
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
KEGG cim:CIMG_02309  -  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSSTEPAPAPAPEPAPAPAAAPAAAAAAPKGMRKNGKNWHDVKTPFRPTKGQTSYARRLEERKAMAAIKEKEKEMKEEKEAERQRRIQAIKDRRAAKEEKERYEKMAEKMHRKRVERRKRREKRNKLLNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.18
4 0.17
5 0.16
6 0.15
7 0.14
8 0.12
9 0.1
10 0.08
11 0.08
12 0.08
13 0.06
14 0.07
15 0.08
16 0.1
17 0.13
18 0.17
19 0.24
20 0.27
21 0.36
22 0.44
23 0.5
24 0.56
25 0.57
26 0.58
27 0.58
28 0.59
29 0.57
30 0.56
31 0.59
32 0.54
33 0.53
34 0.51
35 0.46
36 0.53
37 0.51
38 0.49
39 0.47
40 0.52
41 0.57
42 0.58
43 0.58
44 0.49
45 0.48
46 0.44
47 0.43
48 0.36
49 0.29
50 0.25
51 0.24
52 0.24
53 0.28
54 0.27
55 0.26
56 0.26
57 0.26
58 0.29
59 0.29
60 0.33
61 0.32
62 0.33
63 0.31
64 0.37
65 0.39
66 0.44
67 0.5
68 0.51
69 0.53
70 0.53
71 0.52
72 0.52
73 0.52
74 0.5
75 0.53
76 0.57
77 0.58
78 0.61
79 0.63
80 0.57
81 0.61
82 0.56
83 0.53
84 0.54
85 0.54
86 0.55
87 0.58
88 0.57
89 0.56
90 0.61
91 0.58
92 0.52
93 0.54
94 0.53
95 0.56
96 0.64
97 0.7
98 0.71
99 0.71
100 0.77
101 0.79
102 0.83
103 0.83
104 0.85
105 0.87
106 0.89
107 0.95
108 0.96
109 0.96
110 0.96