Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A010QGA9

Protein Details
Accession A0A010QGA9    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
107-126TDKAKKRTTHFPQRKFAVKVHydrophilic
NLS Segment(s)
PositionSequence
95-97RRR
Subcellular Location(s) nucl 17, cyto_nucl 10, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG cfj:CFIO01_11167  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSQSSGKVKAVALWSKNKDDLTKQLGELKTELGQLRIQKIASSGSKLNKIHDIRKSIARVLTVINSKQRAQLRLFYKNKKYAPLDLRAKQTRAIRRRLSEKEASAVTDKAKKRTTHFPQRKFAVKVSRVGISAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.48
3 0.51
4 0.49
5 0.45
6 0.42
7 0.45
8 0.42
9 0.39
10 0.36
11 0.4
12 0.39
13 0.37
14 0.34
15 0.28
16 0.23
17 0.24
18 0.23
19 0.17
20 0.19
21 0.2
22 0.22
23 0.22
24 0.2
25 0.17
26 0.17
27 0.2
28 0.19
29 0.2
30 0.21
31 0.23
32 0.3
33 0.3
34 0.31
35 0.35
36 0.37
37 0.4
38 0.41
39 0.42
40 0.38
41 0.43
42 0.43
43 0.37
44 0.35
45 0.29
46 0.24
47 0.21
48 0.22
49 0.18
50 0.18
51 0.19
52 0.2
53 0.2
54 0.24
55 0.26
56 0.26
57 0.25
58 0.31
59 0.32
60 0.41
61 0.47
62 0.49
63 0.53
64 0.58
65 0.58
66 0.57
67 0.55
68 0.53
69 0.51
70 0.53
71 0.54
72 0.51
73 0.58
74 0.55
75 0.54
76 0.5
77 0.52
78 0.53
79 0.52
80 0.56
81 0.55
82 0.57
83 0.65
84 0.66
85 0.66
86 0.62
87 0.57
88 0.52
89 0.46
90 0.42
91 0.36
92 0.31
93 0.28
94 0.29
95 0.31
96 0.34
97 0.4
98 0.41
99 0.44
100 0.53
101 0.6
102 0.64
103 0.71
104 0.73
105 0.76
106 0.79
107 0.83
108 0.76
109 0.73
110 0.72
111 0.65
112 0.63
113 0.57
114 0.53