Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A010Q9M1

Protein Details
Accession A0A010Q9M1   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
16-35IPTPRPPTPRMRKTIPRTTPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 6.5, cyto_nucl 6, cyto 4.5
Family & Domain DBs
KEGG cfj:CFIO01_13338  -  
Amino Acid Sequences MLLTQTPIPPPHLNTIPTPRPPTPRMRKTIPRTTPIHAARSRLRAPFLAAHVGPAIRRQRQVEAQHAQHHHRLRQDDRLADLLAALDGAFVVGTVAAQGRALVLTAAVSAGVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.46
3 0.47
4 0.51
5 0.54
6 0.51
7 0.54
8 0.56
9 0.61
10 0.63
11 0.65
12 0.65
13 0.68
14 0.73
15 0.75
16 0.81
17 0.77
18 0.73
19 0.67
20 0.64
21 0.65
22 0.58
23 0.58
24 0.49
25 0.47
26 0.45
27 0.48
28 0.48
29 0.4
30 0.38
31 0.3
32 0.31
33 0.29
34 0.26
35 0.22
36 0.18
37 0.17
38 0.16
39 0.15
40 0.13
41 0.16
42 0.19
43 0.17
44 0.2
45 0.21
46 0.24
47 0.31
48 0.35
49 0.37
50 0.38
51 0.39
52 0.43
53 0.45
54 0.44
55 0.43
56 0.43
57 0.39
58 0.38
59 0.41
60 0.38
61 0.44
62 0.46
63 0.41
64 0.4
65 0.39
66 0.34
67 0.28
68 0.24
69 0.15
70 0.1
71 0.08
72 0.06
73 0.03
74 0.03
75 0.03
76 0.02
77 0.02
78 0.02
79 0.02
80 0.02
81 0.03
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.05
88 0.05
89 0.05
90 0.04
91 0.04
92 0.04
93 0.05