Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3KCT4

Protein Details
Accession J3KCT4    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-35DDFPHKCKSSPKNIRPSKRSDDCHydrophilic
NLS Segment(s)
PositionSequence
52-64RREVRRDQSRKER
Subcellular Location(s) nucl 14, plas 6, mito 4, cyto 2
Family & Domain DBs
KEGG cim:CIMG_13768  -  
Amino Acid Sequences MVAWFWTSRARTDDFPHKCKSSPKNIRPSKRSDDCKKPGSQPYDAFPVRRDRREVRRDQSRKERPRSHQISMHSRNEWDQNPLVHGNTPGFCYEPQTPKLTFAAIELGNISALLVCYPFVCLGCLKRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.51
3 0.54
4 0.53
5 0.53
6 0.59
7 0.6
8 0.61
9 0.64
10 0.68
11 0.72
12 0.79
13 0.86
14 0.82
15 0.82
16 0.81
17 0.79
18 0.8
19 0.78
20 0.79
21 0.76
22 0.77
23 0.73
24 0.71
25 0.69
26 0.64
27 0.61
28 0.52
29 0.48
30 0.5
31 0.46
32 0.39
33 0.34
34 0.39
35 0.39
36 0.4
37 0.42
38 0.41
39 0.5
40 0.59
41 0.65
42 0.62
43 0.68
44 0.7
45 0.72
46 0.76
47 0.76
48 0.76
49 0.78
50 0.78
51 0.73
52 0.79
53 0.77
54 0.7
55 0.64
56 0.61
57 0.62
58 0.6
59 0.58
60 0.48
61 0.42
62 0.4
63 0.4
64 0.35
65 0.28
66 0.24
67 0.2
68 0.22
69 0.22
70 0.21
71 0.17
72 0.17
73 0.15
74 0.14
75 0.15
76 0.12
77 0.13
78 0.12
79 0.16
80 0.21
81 0.24
82 0.27
83 0.3
84 0.3
85 0.31
86 0.31
87 0.28
88 0.22
89 0.17
90 0.19
91 0.15
92 0.15
93 0.13
94 0.12
95 0.11
96 0.11
97 0.1
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.07
105 0.08
106 0.08
107 0.09
108 0.12