Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A010R9W7

Protein Details
Accession A0A010R9W7   
Localization Confidence High
Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
47-73SLYEHPPPPRSPKRHRHSRQVEAKSDTHydrophilic
NLS Segment(s)
PositionSequence
55-62PRSPKRHR
119-143RRRRRKPKAELELEPVIKRASKRRR
Subcellular Location(s) nucl 19, mito 5, cyto 2
Family & Domain DBs
KEGG cfj:CFIO01_12228  -  
Amino Acid Sequences MSKRASKRRHASPEPDLSLTEGLPTIKTRRYPPRKDVEYHETGRHRSLYEHPPPPRSPKRHRHSRQVEAKSDTDGDLKMIPMPPGSPSTALVLRTARAPGHNQDHRKNNDDGGYLDIVRRRRRKPKAELELEPVIKRASKRRRSITDDARHEIHQRQQDNDLVVDNYRFRNHILSLLDEQRSSVESWALSVGVGGPAEPMDWQPEQERVVYIARDLVEYDCYEDRWRIGGGQEQQQQMEDWSTAQLSSELVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.69
3 0.59
4 0.51
5 0.43
6 0.34
7 0.26
8 0.17
9 0.13
10 0.13
11 0.16
12 0.18
13 0.21
14 0.26
15 0.33
16 0.43
17 0.54
18 0.61
19 0.68
20 0.74
21 0.76
22 0.76
23 0.76
24 0.73
25 0.7
26 0.65
27 0.63
28 0.57
29 0.54
30 0.52
31 0.46
32 0.38
33 0.34
34 0.37
35 0.39
36 0.43
37 0.49
38 0.51
39 0.55
40 0.58
41 0.66
42 0.68
43 0.68
44 0.7
45 0.72
46 0.77
47 0.82
48 0.86
49 0.87
50 0.86
51 0.87
52 0.87
53 0.84
54 0.8
55 0.74
56 0.67
57 0.58
58 0.49
59 0.39
60 0.3
61 0.22
62 0.17
63 0.13
64 0.12
65 0.12
66 0.12
67 0.11
68 0.1
69 0.1
70 0.11
71 0.12
72 0.13
73 0.12
74 0.12
75 0.14
76 0.16
77 0.16
78 0.16
79 0.15
80 0.14
81 0.14
82 0.15
83 0.13
84 0.12
85 0.15
86 0.18
87 0.26
88 0.33
89 0.37
90 0.43
91 0.51
92 0.53
93 0.54
94 0.5
95 0.44
96 0.4
97 0.35
98 0.29
99 0.22
100 0.2
101 0.15
102 0.15
103 0.16
104 0.19
105 0.25
106 0.32
107 0.37
108 0.46
109 0.55
110 0.64
111 0.7
112 0.76
113 0.79
114 0.78
115 0.73
116 0.69
117 0.64
118 0.56
119 0.46
120 0.36
121 0.27
122 0.22
123 0.21
124 0.25
125 0.3
126 0.38
127 0.45
128 0.53
129 0.61
130 0.67
131 0.75
132 0.75
133 0.74
134 0.71
135 0.66
136 0.6
137 0.54
138 0.48
139 0.42
140 0.38
141 0.35
142 0.31
143 0.3
144 0.31
145 0.32
146 0.3
147 0.28
148 0.23
149 0.17
150 0.16
151 0.15
152 0.14
153 0.13
154 0.13
155 0.13
156 0.13
157 0.15
158 0.15
159 0.19
160 0.18
161 0.2
162 0.23
163 0.27
164 0.27
165 0.24
166 0.23
167 0.19
168 0.19
169 0.16
170 0.13
171 0.1
172 0.09
173 0.1
174 0.1
175 0.09
176 0.07
177 0.07
178 0.06
179 0.06
180 0.06
181 0.05
182 0.05
183 0.05
184 0.05
185 0.05
186 0.06
187 0.09
188 0.09
189 0.11
190 0.13
191 0.16
192 0.17
193 0.17
194 0.18
195 0.16
196 0.19
197 0.17
198 0.16
199 0.16
200 0.15
201 0.15
202 0.15
203 0.14
204 0.13
205 0.13
206 0.17
207 0.15
208 0.16
209 0.18
210 0.19
211 0.19
212 0.19
213 0.19
214 0.17
215 0.18
216 0.24
217 0.27
218 0.35
219 0.4
220 0.4
221 0.39
222 0.39
223 0.37
224 0.31
225 0.28
226 0.2
227 0.14
228 0.14
229 0.14
230 0.13
231 0.13
232 0.11