Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A010RXH8

Protein Details
Accession A0A010RXH8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
360-379LAGMTKKKTFDPPRNEKDELHydrophilic
NLS Segment(s)
PositionSequence
93-93R
Subcellular Location(s) extr 13, cyto 4, plas 3, cyto_pero 3, pero 2, vacu 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR006035  Ureohydrolase  
IPR023696  Ureohydrolase_dom_sf  
IPR020855  Ureohydrolase_Mn_BS  
Gene Ontology GO:0016813  F:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines  
GO:0046872  F:metal ion binding  
KEGG cfj:CFIO01_02520  -  
Pfam View protein in Pfam  
PF00491  Arginase  
PROSITE View protein in PROSITE  
PS01053  ARGINASE_1  
PS51409  ARGINASE_2  
CDD cd11592  Agmatinase_PAH  
Amino Acid Sequences MRLADAILLCAGADLAAALNVGPNYQYPLEDLDKDLPFSQPVTFAHLEWQRCLAESHNKPLDIAVLGFPYDTSTSYRPGARFGPRGIRAGSSREKKGRSYNTVWEVDPYEQGLEIPRRKIDCGDVPITPFDASHAFKQMEQAYRQILYHPTTDQNEWEHPRIISLGGDHSIVLPILRSLKTVYGPISVIHLDSHLDTWDPYEGYTGIVSNQSAITHGTFFWHASREGCISKGTSVHGGLRTKLFSPKDYEIDRDVVGFTIIEAHEIDDIGMSGIVKKVRDAVGNTPVYLSIDIDVLDPSIAPATGTPESGGWTTRELKRFLKGLEGLNLVGADVVEVSPPYDSVAETTSVAAADLIVDILAGMTKKKTFDPPRNEKDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.04
5 0.03
6 0.06
7 0.06
8 0.06
9 0.07
10 0.07
11 0.12
12 0.12
13 0.13
14 0.12
15 0.18
16 0.21
17 0.22
18 0.25
19 0.27
20 0.27
21 0.29
22 0.28
23 0.24
24 0.22
25 0.22
26 0.2
27 0.17
28 0.17
29 0.23
30 0.23
31 0.22
32 0.28
33 0.33
34 0.34
35 0.31
36 0.34
37 0.27
38 0.27
39 0.27
40 0.25
41 0.3
42 0.33
43 0.41
44 0.42
45 0.42
46 0.41
47 0.4
48 0.37
49 0.28
50 0.24
51 0.16
52 0.11
53 0.11
54 0.11
55 0.11
56 0.1
57 0.1
58 0.1
59 0.12
60 0.13
61 0.17
62 0.2
63 0.24
64 0.23
65 0.26
66 0.31
67 0.34
68 0.37
69 0.38
70 0.44
71 0.43
72 0.45
73 0.43
74 0.4
75 0.35
76 0.38
77 0.43
78 0.4
79 0.45
80 0.48
81 0.5
82 0.51
83 0.59
84 0.61
85 0.6
86 0.59
87 0.6
88 0.6
89 0.6
90 0.55
91 0.48
92 0.41
93 0.34
94 0.29
95 0.21
96 0.14
97 0.12
98 0.12
99 0.14
100 0.19
101 0.21
102 0.23
103 0.26
104 0.27
105 0.28
106 0.29
107 0.3
108 0.29
109 0.31
110 0.31
111 0.28
112 0.28
113 0.28
114 0.27
115 0.22
116 0.16
117 0.12
118 0.13
119 0.14
120 0.14
121 0.18
122 0.17
123 0.18
124 0.22
125 0.25
126 0.26
127 0.26
128 0.26
129 0.24
130 0.24
131 0.24
132 0.21
133 0.2
134 0.18
135 0.18
136 0.18
137 0.19
138 0.21
139 0.21
140 0.21
141 0.21
142 0.24
143 0.26
144 0.27
145 0.25
146 0.22
147 0.22
148 0.21
149 0.18
150 0.13
151 0.1
152 0.09
153 0.08
154 0.08
155 0.07
156 0.07
157 0.07
158 0.06
159 0.05
160 0.04
161 0.04
162 0.07
163 0.07
164 0.07
165 0.08
166 0.09
167 0.1
168 0.12
169 0.12
170 0.11
171 0.11
172 0.1
173 0.11
174 0.1
175 0.1
176 0.08
177 0.08
178 0.07
179 0.07
180 0.07
181 0.05
182 0.05
183 0.05
184 0.06
185 0.07
186 0.06
187 0.06
188 0.06
189 0.06
190 0.07
191 0.07
192 0.06
193 0.06
194 0.06
195 0.06
196 0.06
197 0.06
198 0.06
199 0.06
200 0.07
201 0.07
202 0.07
203 0.07
204 0.07
205 0.08
206 0.09
207 0.09
208 0.1
209 0.1
210 0.1
211 0.12
212 0.14
213 0.14
214 0.14
215 0.14
216 0.13
217 0.13
218 0.14
219 0.13
220 0.12
221 0.13
222 0.15
223 0.19
224 0.19
225 0.2
226 0.2
227 0.21
228 0.2
229 0.26
230 0.24
231 0.22
232 0.27
233 0.29
234 0.32
235 0.33
236 0.34
237 0.3
238 0.3
239 0.28
240 0.22
241 0.19
242 0.14
243 0.12
244 0.09
245 0.07
246 0.08
247 0.07
248 0.08
249 0.07
250 0.08
251 0.08
252 0.08
253 0.08
254 0.05
255 0.05
256 0.04
257 0.05
258 0.04
259 0.05
260 0.07
261 0.09
262 0.09
263 0.09
264 0.13
265 0.15
266 0.18
267 0.21
268 0.24
269 0.31
270 0.32
271 0.32
272 0.28
273 0.26
274 0.24
275 0.21
276 0.16
277 0.08
278 0.07
279 0.08
280 0.08
281 0.08
282 0.07
283 0.06
284 0.06
285 0.05
286 0.05
287 0.05
288 0.04
289 0.05
290 0.1
291 0.1
292 0.11
293 0.11
294 0.11
295 0.13
296 0.14
297 0.15
298 0.11
299 0.14
300 0.21
301 0.26
302 0.31
303 0.33
304 0.36
305 0.4
306 0.43
307 0.4
308 0.41
309 0.39
310 0.38
311 0.39
312 0.38
313 0.32
314 0.28
315 0.27
316 0.19
317 0.15
318 0.11
319 0.06
320 0.05
321 0.05
322 0.04
323 0.05
324 0.05
325 0.05
326 0.06
327 0.07
328 0.07
329 0.07
330 0.08
331 0.1
332 0.12
333 0.12
334 0.12
335 0.11
336 0.11
337 0.11
338 0.09
339 0.07
340 0.06
341 0.05
342 0.05
343 0.04
344 0.04
345 0.03
346 0.03
347 0.05
348 0.05
349 0.07
350 0.1
351 0.12
352 0.15
353 0.19
354 0.3
355 0.39
356 0.49
357 0.59
358 0.67
359 0.74