Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3K716

Protein Details
Accession J3K716    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
8-37KNSAYYSRYQTKFKRRRQGKTDYYARKRLIHydrophilic
271-295KAESLKYKAKKLSRAEKNARAQEKIHydrophilic
NLS Segment(s)
PositionSequence
260-292EAGPKKSKEEWKAESLKYKAKKLSRAEKNARAQ
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 7.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005485  Rbsml_L5_euk/L18_arc  
IPR025607  Rbsml_L5e_C  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0008097  F:5S rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cim:CIMG_05906  -  
Pfam View protein in Pfam  
PF14204  Ribosomal_L18_c  
PF17144  Ribosomal_L5e  
CDD cd00432  Ribosomal_L18_L5e  
Amino Acid Sequences MPFTKLVKNSAYYSRYQTKFKRRRQGKTDYYARKRLITQAKNKYNSPKYRLVVRFTNRDIITQIVTSELTGDKVIACAYAHELKRYGIKNGLTNWSAAYATGLLLARRTLKKLGLDEDFVGVEEPEGEFTLTEAAETDEGTRRPFKAFLDVGLHRTSTGARVFAAMKGASDGGILVPHSENRFPGFDIETEELDAETLRKYIFGGHVAEYMEGLADDDEERYKSQFQMYIDNGLEAGELEDMYAEAHKAIREDPFKKDEEAGPKKSKEEWKAESLKYKAKKLSRAEKNARAQEKIRELAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.56
4 0.62
5 0.64
6 0.72
7 0.78
8 0.82
9 0.82
10 0.88
11 0.88
12 0.89
13 0.88
14 0.87
15 0.88
16 0.88
17 0.86
18 0.84
19 0.78
20 0.72
21 0.64
22 0.63
23 0.63
24 0.62
25 0.64
26 0.66
27 0.73
28 0.73
29 0.75
30 0.76
31 0.75
32 0.75
33 0.72
34 0.7
35 0.63
36 0.69
37 0.69
38 0.65
39 0.64
40 0.62
41 0.63
42 0.56
43 0.62
44 0.52
45 0.48
46 0.43
47 0.36
48 0.31
49 0.23
50 0.2
51 0.13
52 0.13
53 0.11
54 0.11
55 0.09
56 0.08
57 0.08
58 0.08
59 0.07
60 0.07
61 0.07
62 0.07
63 0.06
64 0.06
65 0.1
66 0.17
67 0.17
68 0.19
69 0.2
70 0.2
71 0.27
72 0.28
73 0.27
74 0.25
75 0.27
76 0.29
77 0.32
78 0.36
79 0.3
80 0.28
81 0.26
82 0.21
83 0.19
84 0.15
85 0.12
86 0.07
87 0.06
88 0.08
89 0.08
90 0.07
91 0.08
92 0.09
93 0.13
94 0.14
95 0.16
96 0.16
97 0.19
98 0.22
99 0.24
100 0.27
101 0.24
102 0.25
103 0.23
104 0.22
105 0.19
106 0.16
107 0.13
108 0.09
109 0.07
110 0.05
111 0.04
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.05
118 0.04
119 0.04
120 0.04
121 0.04
122 0.05
123 0.05
124 0.06
125 0.08
126 0.09
127 0.11
128 0.12
129 0.12
130 0.14
131 0.15
132 0.14
133 0.18
134 0.18
135 0.18
136 0.22
137 0.22
138 0.23
139 0.22
140 0.21
141 0.15
142 0.15
143 0.13
144 0.11
145 0.11
146 0.09
147 0.08
148 0.09
149 0.1
150 0.1
151 0.12
152 0.09
153 0.08
154 0.08
155 0.08
156 0.07
157 0.06
158 0.05
159 0.04
160 0.04
161 0.04
162 0.04
163 0.05
164 0.07
165 0.08
166 0.09
167 0.09
168 0.11
169 0.12
170 0.12
171 0.13
172 0.13
173 0.12
174 0.15
175 0.16
176 0.14
177 0.14
178 0.13
179 0.11
180 0.1
181 0.1
182 0.06
183 0.05
184 0.05
185 0.05
186 0.05
187 0.05
188 0.08
189 0.09
190 0.11
191 0.13
192 0.13
193 0.15
194 0.16
195 0.16
196 0.13
197 0.11
198 0.09
199 0.06
200 0.06
201 0.04
202 0.04
203 0.04
204 0.05
205 0.06
206 0.07
207 0.08
208 0.1
209 0.12
210 0.12
211 0.15
212 0.18
213 0.18
214 0.25
215 0.26
216 0.29
217 0.28
218 0.27
219 0.24
220 0.2
221 0.18
222 0.11
223 0.1
224 0.05
225 0.04
226 0.04
227 0.04
228 0.04
229 0.05
230 0.05
231 0.04
232 0.05
233 0.06
234 0.07
235 0.08
236 0.1
237 0.17
238 0.25
239 0.28
240 0.34
241 0.37
242 0.39
243 0.4
244 0.41
245 0.4
246 0.43
247 0.48
248 0.51
249 0.54
250 0.54
251 0.55
252 0.59
253 0.62
254 0.59
255 0.6
256 0.58
257 0.59
258 0.65
259 0.67
260 0.68
261 0.64
262 0.65
263 0.63
264 0.65
265 0.64
266 0.63
267 0.68
268 0.69
269 0.74
270 0.76
271 0.81
272 0.83
273 0.84
274 0.87
275 0.87
276 0.83
277 0.78
278 0.71
279 0.7
280 0.68