Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A010RXN4

Protein Details
Accession A0A010RXN4   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
74-104VARVKKEYEDKQKKKKEKEEKEKEKDKVKEKBasic
NLS Segment(s)
PositionSequence
65-113KKKKALEDEVARVKKEYEDKQKKKKEKEEKEKEKDKVKEKEKEKDKDDK
Subcellular Location(s) nucl 15.5, cyto_nucl 12.833, mito_nucl 9.666, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
KEGG cfj:CFIO01_02560  -  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MSFSNIYTHRKVAETAAKGCDVCYRATSSVLVAPENKDFFYVCPSHLKDKNFCSPIIDKEAVEAKKKKALEDEVARVKKEYEDKQKKKKEKEEKEKEKDKVKEKEKEKDKDDKKTEDEKEDSAKASSLISRLLLLGSFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.37
4 0.37
5 0.35
6 0.34
7 0.33
8 0.25
9 0.21
10 0.2
11 0.21
12 0.2
13 0.22
14 0.22
15 0.18
16 0.19
17 0.19
18 0.18
19 0.15
20 0.16
21 0.18
22 0.19
23 0.18
24 0.15
25 0.15
26 0.14
27 0.18
28 0.17
29 0.15
30 0.21
31 0.24
32 0.31
33 0.36
34 0.39
35 0.38
36 0.43
37 0.5
38 0.44
39 0.42
40 0.38
41 0.36
42 0.35
43 0.37
44 0.32
45 0.23
46 0.23
47 0.29
48 0.26
49 0.3
50 0.3
51 0.25
52 0.29
53 0.29
54 0.29
55 0.26
56 0.28
57 0.29
58 0.3
59 0.34
60 0.38
61 0.39
62 0.38
63 0.34
64 0.31
65 0.28
66 0.3
67 0.32
68 0.35
69 0.45
70 0.54
71 0.65
72 0.74
73 0.8
74 0.83
75 0.86
76 0.86
77 0.86
78 0.88
79 0.89
80 0.9
81 0.91
82 0.91
83 0.86
84 0.84
85 0.81
86 0.79
87 0.77
88 0.75
89 0.75
90 0.73
91 0.77
92 0.77
93 0.78
94 0.74
95 0.75
96 0.74
97 0.76
98 0.75
99 0.72
100 0.69
101 0.7
102 0.69
103 0.66
104 0.62
105 0.55
106 0.53
107 0.48
108 0.43
109 0.35
110 0.3
111 0.23
112 0.21
113 0.2
114 0.16
115 0.15
116 0.14
117 0.13
118 0.13
119 0.13