Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A010R9T1

Protein Details
Accession A0A010R9T1    Localization Confidence High Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
111-140DVKKTTTAVDPKKNKKKSNKPAKPATQQPTHydrophilic
324-350KLNDGTTKEKAPRRRKRRTNVDDSSSEHydrophilic
NLS Segment(s)
PositionSequence
122-133KKNKKKSNKPAK
331-341KEKAPRRRKRR
414-421KKRTGSKK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019327  WKF  
KEGG cfj:CFIO01_01962  -  
Pfam View protein in Pfam  
PF10180  WKF  
Amino Acid Sequences MSSAPNVPAWKRLGLKLKQPASGAEIGGPAPAEGSKPNGQQHHDRDTSGPVVNAAYASPAAAAAAKRKRLDQPTPPPAYNSNSPFKRTRTDGDSNATPTLRKQKSVTFADDVKKTTTAVDPKKNKKKSNKPAKPATQQPTADIKPSLEYLRTWKSARQSWKFNKNHQTILMKRVFHADAIPSSDIGTFYEYIQDLKGFTRSRLRETAAEVKKEDAEKGKAAFPVGTPDMDSKQSEYETVLAGLMQLGNGSGSKRKRFDEAGFVSKSTDVAITQRVIKRMRAETILEELSDSEDSDAMTIDTEETAPPPQAAATQEDESADKRVKLNDGTTKEKAPRRRKRRTNVDDSSSEESSDSDSSDSDSDSESEDESDNASEVQRQAAQREAETSSESSSSSEEEDDSSEDDSEEDEEAPKKRTGSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.58
3 0.62
4 0.64
5 0.62
6 0.59
7 0.54
8 0.49
9 0.46
10 0.37
11 0.28
12 0.24
13 0.2
14 0.19
15 0.17
16 0.11
17 0.09
18 0.08
19 0.08
20 0.08
21 0.14
22 0.19
23 0.25
24 0.31
25 0.36
26 0.41
27 0.49
28 0.55
29 0.58
30 0.55
31 0.51
32 0.47
33 0.46
34 0.46
35 0.38
36 0.31
37 0.22
38 0.21
39 0.19
40 0.17
41 0.12
42 0.1
43 0.08
44 0.07
45 0.06
46 0.06
47 0.06
48 0.08
49 0.09
50 0.16
51 0.23
52 0.29
53 0.3
54 0.35
55 0.43
56 0.5
57 0.57
58 0.6
59 0.64
60 0.68
61 0.73
62 0.7
63 0.65
64 0.6
65 0.57
66 0.53
67 0.48
68 0.48
69 0.45
70 0.49
71 0.51
72 0.51
73 0.51
74 0.48
75 0.49
76 0.47
77 0.51
78 0.51
79 0.51
80 0.52
81 0.49
82 0.47
83 0.41
84 0.33
85 0.31
86 0.37
87 0.32
88 0.32
89 0.32
90 0.35
91 0.43
92 0.48
93 0.48
94 0.42
95 0.46
96 0.48
97 0.48
98 0.44
99 0.37
100 0.33
101 0.28
102 0.25
103 0.26
104 0.29
105 0.34
106 0.42
107 0.5
108 0.6
109 0.71
110 0.78
111 0.81
112 0.83
113 0.86
114 0.87
115 0.89
116 0.89
117 0.87
118 0.89
119 0.89
120 0.86
121 0.85
122 0.8
123 0.76
124 0.67
125 0.62
126 0.59
127 0.5
128 0.44
129 0.35
130 0.3
131 0.22
132 0.24
133 0.21
134 0.14
135 0.14
136 0.18
137 0.22
138 0.25
139 0.25
140 0.27
141 0.31
142 0.37
143 0.46
144 0.46
145 0.52
146 0.57
147 0.67
148 0.69
149 0.72
150 0.76
151 0.7
152 0.67
153 0.62
154 0.61
155 0.53
156 0.56
157 0.52
158 0.42
159 0.38
160 0.39
161 0.34
162 0.26
163 0.24
164 0.17
165 0.13
166 0.16
167 0.15
168 0.11
169 0.12
170 0.11
171 0.11
172 0.09
173 0.1
174 0.07
175 0.07
176 0.09
177 0.09
178 0.09
179 0.09
180 0.09
181 0.08
182 0.08
183 0.13
184 0.12
185 0.13
186 0.21
187 0.23
188 0.27
189 0.29
190 0.31
191 0.27
192 0.31
193 0.4
194 0.35
195 0.36
196 0.32
197 0.3
198 0.29
199 0.28
200 0.25
201 0.19
202 0.17
203 0.17
204 0.18
205 0.2
206 0.18
207 0.18
208 0.17
209 0.13
210 0.15
211 0.14
212 0.13
213 0.11
214 0.12
215 0.13
216 0.14
217 0.14
218 0.11
219 0.12
220 0.12
221 0.11
222 0.11
223 0.1
224 0.09
225 0.09
226 0.07
227 0.06
228 0.06
229 0.05
230 0.05
231 0.03
232 0.03
233 0.03
234 0.03
235 0.04
236 0.05
237 0.1
238 0.14
239 0.2
240 0.23
241 0.24
242 0.28
243 0.32
244 0.34
245 0.39
246 0.4
247 0.41
248 0.39
249 0.38
250 0.35
251 0.3
252 0.27
253 0.18
254 0.13
255 0.07
256 0.08
257 0.1
258 0.11
259 0.16
260 0.19
261 0.23
262 0.25
263 0.27
264 0.32
265 0.33
266 0.34
267 0.31
268 0.31
269 0.27
270 0.3
271 0.27
272 0.21
273 0.18
274 0.15
275 0.14
276 0.12
277 0.11
278 0.07
279 0.06
280 0.06
281 0.06
282 0.06
283 0.05
284 0.05
285 0.05
286 0.05
287 0.05
288 0.05
289 0.05
290 0.06
291 0.08
292 0.08
293 0.08
294 0.07
295 0.07
296 0.09
297 0.11
298 0.13
299 0.16
300 0.16
301 0.17
302 0.17
303 0.18
304 0.17
305 0.19
306 0.18
307 0.16
308 0.17
309 0.2
310 0.23
311 0.25
312 0.3
313 0.35
314 0.38
315 0.44
316 0.44
317 0.47
318 0.52
319 0.55
320 0.6
321 0.62
322 0.68
323 0.71
324 0.8
325 0.85
326 0.88
327 0.93
328 0.93
329 0.93
330 0.9
331 0.86
332 0.78
333 0.73
334 0.67
335 0.56
336 0.46
337 0.35
338 0.27
339 0.23
340 0.2
341 0.16
342 0.1
343 0.1
344 0.11
345 0.12
346 0.12
347 0.1
348 0.11
349 0.11
350 0.12
351 0.13
352 0.12
353 0.13
354 0.13
355 0.12
356 0.12
357 0.12
358 0.1
359 0.1
360 0.1
361 0.12
362 0.12
363 0.15
364 0.18
365 0.19
366 0.21
367 0.27
368 0.28
369 0.26
370 0.29
371 0.28
372 0.24
373 0.26
374 0.25
375 0.21
376 0.19
377 0.19
378 0.16
379 0.16
380 0.15
381 0.14
382 0.14
383 0.13
384 0.13
385 0.14
386 0.15
387 0.15
388 0.15
389 0.14
390 0.13
391 0.12
392 0.12
393 0.11
394 0.11
395 0.11
396 0.12
397 0.16
398 0.19
399 0.23
400 0.25
401 0.27