Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A010RLI9

Protein Details
Accession A0A010RLI9   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
14-37GNGEGGQKAKKQKKKSAYQVDETLHydrophilic
NLS Segment(s)
PositionSequence
21-28KAKKQKKK
Subcellular Location(s) nucl 8cyto 8cyto_nucl 8, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR032704  Cms1  
IPR027417  P-loop_NTPase  
KEGG cfj:CFIO01_01658  -  
Pfam View protein in Pfam  
PF14617  CMS1  
Amino Acid Sequences MSNTKKRAAPSQDGNGEGGQKAKKQKKKSAYQVDETLLNAELGINESFAVMDNQLLADYTAQKISRFGTDLSPVELSDLSISANVIKDTTSWTQPRALDKLPAFLENFAERPDRLFTAPKVKGAPHTIIVAAAGLRAADVVRAVRKFQGKESTVSKLFAKHMKVDEQVQFLQKTRTGIAVGTPARLMELVDNGALNLDKLQRLVVDASHIDQKKRGIMDMKDTMLPLARWLSRKEFKERYGDEQKPLDLIFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.49
3 0.43
4 0.34
5 0.31
6 0.25
7 0.26
8 0.34
9 0.43
10 0.5
11 0.58
12 0.67
13 0.72
14 0.8
15 0.86
16 0.87
17 0.85
18 0.83
19 0.79
20 0.71
21 0.62
22 0.52
23 0.42
24 0.31
25 0.23
26 0.16
27 0.1
28 0.08
29 0.09
30 0.08
31 0.07
32 0.06
33 0.07
34 0.07
35 0.07
36 0.08
37 0.06
38 0.05
39 0.05
40 0.06
41 0.06
42 0.06
43 0.05
44 0.06
45 0.07
46 0.08
47 0.11
48 0.12
49 0.12
50 0.14
51 0.15
52 0.16
53 0.16
54 0.17
55 0.16
56 0.2
57 0.21
58 0.22
59 0.21
60 0.18
61 0.17
62 0.16
63 0.13
64 0.09
65 0.08
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.1
76 0.12
77 0.17
78 0.17
79 0.19
80 0.23
81 0.26
82 0.29
83 0.29
84 0.28
85 0.29
86 0.28
87 0.31
88 0.27
89 0.26
90 0.23
91 0.19
92 0.2
93 0.15
94 0.15
95 0.12
96 0.13
97 0.11
98 0.12
99 0.13
100 0.12
101 0.13
102 0.15
103 0.15
104 0.24
105 0.25
106 0.25
107 0.25
108 0.24
109 0.26
110 0.27
111 0.26
112 0.18
113 0.18
114 0.16
115 0.14
116 0.13
117 0.1
118 0.07
119 0.05
120 0.04
121 0.03
122 0.02
123 0.03
124 0.02
125 0.02
126 0.03
127 0.04
128 0.07
129 0.08
130 0.09
131 0.13
132 0.18
133 0.19
134 0.22
135 0.3
136 0.28
137 0.32
138 0.34
139 0.36
140 0.33
141 0.34
142 0.3
143 0.25
144 0.27
145 0.28
146 0.27
147 0.25
148 0.27
149 0.29
150 0.3
151 0.32
152 0.32
153 0.3
154 0.3
155 0.29
156 0.28
157 0.26
158 0.26
159 0.23
160 0.21
161 0.18
162 0.18
163 0.15
164 0.14
165 0.14
166 0.19
167 0.17
168 0.17
169 0.16
170 0.14
171 0.14
172 0.14
173 0.13
174 0.06
175 0.07
176 0.07
177 0.08
178 0.08
179 0.07
180 0.08
181 0.07
182 0.07
183 0.07
184 0.08
185 0.09
186 0.09
187 0.1
188 0.09
189 0.11
190 0.12
191 0.1
192 0.12
193 0.12
194 0.14
195 0.22
196 0.24
197 0.23
198 0.25
199 0.28
200 0.29
201 0.3
202 0.32
203 0.31
204 0.32
205 0.39
206 0.42
207 0.42
208 0.38
209 0.37
210 0.33
211 0.29
212 0.26
213 0.2
214 0.2
215 0.22
216 0.24
217 0.28
218 0.36
219 0.42
220 0.47
221 0.54
222 0.57
223 0.58
224 0.65
225 0.65
226 0.65
227 0.67
228 0.67
229 0.64
230 0.6
231 0.56
232 0.48