Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A010S1D1

Protein Details
Accession A0A010S1D1   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
210-231FDELEEKKKKKDEKVKVLTRSVBasic
NLS Segment(s)
PositionSequence
216-221KKKKKD
Subcellular Location(s) cyto 12, cyto_mito 10.333, cyto_nucl 9.333, mito 7.5, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009267  NTP_transf_6  
KEGG cfj:CFIO01_02714  -  
Pfam View protein in Pfam  
PF06042  NTP_transf_6  
Amino Acid Sequences MPAVNLARLPLGEQLTLVRQVLETNKTLLKVLSLATTLNLPNWYLAGGAVSQTIWNHVSSLPPTTGISDYDLVYHDDSDLSYEAEDAVIRRGRELFAGIPGEGVEIRNQARVHLWYEEKFGAPCPAHESTEAGIDTWITTSAMIGVRVEADGAWRVYAPRGLSEFFSMIVRPNPTVGVQEAYEKKARRWVGIWKDLKVMPWTENETPMRFDELEEKKKKKDEKVKVLTRSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.2
4 0.19
5 0.14
6 0.13
7 0.16
8 0.2
9 0.22
10 0.2
11 0.22
12 0.23
13 0.24
14 0.25
15 0.22
16 0.18
17 0.15
18 0.15
19 0.13
20 0.12
21 0.11
22 0.11
23 0.13
24 0.12
25 0.13
26 0.13
27 0.11
28 0.11
29 0.11
30 0.1
31 0.08
32 0.08
33 0.07
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.09
41 0.09
42 0.09
43 0.1
44 0.1
45 0.12
46 0.13
47 0.16
48 0.14
49 0.14
50 0.14
51 0.15
52 0.15
53 0.13
54 0.15
55 0.13
56 0.13
57 0.12
58 0.13
59 0.13
60 0.12
61 0.11
62 0.09
63 0.08
64 0.08
65 0.09
66 0.08
67 0.07
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.05
74 0.08
75 0.11
76 0.1
77 0.11
78 0.12
79 0.12
80 0.12
81 0.14
82 0.1
83 0.1
84 0.11
85 0.11
86 0.1
87 0.09
88 0.09
89 0.08
90 0.08
91 0.05
92 0.07
93 0.07
94 0.11
95 0.11
96 0.11
97 0.12
98 0.14
99 0.15
100 0.16
101 0.17
102 0.14
103 0.17
104 0.18
105 0.16
106 0.15
107 0.14
108 0.15
109 0.13
110 0.13
111 0.15
112 0.16
113 0.17
114 0.17
115 0.18
116 0.14
117 0.17
118 0.16
119 0.11
120 0.09
121 0.09
122 0.08
123 0.07
124 0.07
125 0.04
126 0.04
127 0.04
128 0.06
129 0.06
130 0.07
131 0.06
132 0.06
133 0.06
134 0.06
135 0.06
136 0.04
137 0.05
138 0.06
139 0.07
140 0.07
141 0.07
142 0.07
143 0.08
144 0.11
145 0.1
146 0.11
147 0.12
148 0.13
149 0.14
150 0.16
151 0.15
152 0.14
153 0.14
154 0.12
155 0.12
156 0.14
157 0.15
158 0.14
159 0.14
160 0.14
161 0.14
162 0.16
163 0.15
164 0.14
165 0.12
166 0.19
167 0.21
168 0.23
169 0.29
170 0.28
171 0.28
172 0.34
173 0.36
174 0.32
175 0.33
176 0.4
177 0.44
178 0.53
179 0.56
180 0.5
181 0.53
182 0.5
183 0.5
184 0.43
185 0.36
186 0.28
187 0.28
188 0.32
189 0.29
190 0.35
191 0.36
192 0.35
193 0.35
194 0.34
195 0.34
196 0.28
197 0.27
198 0.3
199 0.36
200 0.44
201 0.51
202 0.54
203 0.56
204 0.64
205 0.71
206 0.72
207 0.74
208 0.75
209 0.77
210 0.83
211 0.86