Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A010QBR5

Protein Details
Accession A0A010QBR5    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MFKKDITSKPKQKLKSSVQRSLRDSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016437  MCT-1/Tma20  
IPR041366  Pre-PUA  
IPR002478  PUA  
IPR015947  PUA-like_sf  
IPR004521  Uncharacterised_CHP00451  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0003723  F:RNA binding  
KEGG cfj:CFIO01_06819  -  
Pfam View protein in Pfam  
PF17832  Pre-PUA  
PF01472  PUA  
PROSITE View protein in PROSITE  
PS50890  PUA  
CDD cd11609  MCT1_N  
cd21155  PUA_MCTS-1-like  
Amino Acid Sequences MFKKDITSKPKQKLKSSVQRSLRDSLLSSYPLLNPYIEEVMPKKASLEQMKLPDRCSLFVCEQQPLFYQQDNATLVPHLKLVHRFPQAFPTIRIDRGAIRFVLSGATLMAPGLTSAGGRLPEPREGAEGVDEEGRWSRELEKGEPVIIMAEGKTEACAVGFLVAGTKEVKDKGKGPVVEEAHFLGDGLWRLGTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.82
4 0.82
5 0.82
6 0.82
7 0.78
8 0.72
9 0.63
10 0.54
11 0.46
12 0.4
13 0.34
14 0.28
15 0.24
16 0.21
17 0.21
18 0.21
19 0.2
20 0.16
21 0.13
22 0.15
23 0.16
24 0.14
25 0.15
26 0.15
27 0.2
28 0.2
29 0.2
30 0.18
31 0.19
32 0.26
33 0.29
34 0.31
35 0.31
36 0.39
37 0.46
38 0.46
39 0.45
40 0.43
41 0.39
42 0.36
43 0.33
44 0.29
45 0.25
46 0.29
47 0.29
48 0.27
49 0.26
50 0.26
51 0.25
52 0.24
53 0.23
54 0.18
55 0.19
56 0.16
57 0.2
58 0.2
59 0.19
60 0.16
61 0.14
62 0.14
63 0.12
64 0.13
65 0.1
66 0.1
67 0.14
68 0.16
69 0.23
70 0.27
71 0.28
72 0.28
73 0.33
74 0.35
75 0.33
76 0.31
77 0.3
78 0.27
79 0.27
80 0.27
81 0.21
82 0.2
83 0.2
84 0.2
85 0.14
86 0.12
87 0.12
88 0.11
89 0.11
90 0.08
91 0.06
92 0.05
93 0.05
94 0.04
95 0.04
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.04
104 0.05
105 0.05
106 0.08
107 0.1
108 0.13
109 0.14
110 0.14
111 0.15
112 0.15
113 0.15
114 0.13
115 0.12
116 0.1
117 0.1
118 0.09
119 0.08
120 0.1
121 0.1
122 0.1
123 0.11
124 0.11
125 0.15
126 0.18
127 0.19
128 0.23
129 0.23
130 0.23
131 0.22
132 0.2
133 0.16
134 0.13
135 0.12
136 0.06
137 0.06
138 0.06
139 0.06
140 0.06
141 0.06
142 0.06
143 0.05
144 0.05
145 0.05
146 0.05
147 0.05
148 0.05
149 0.06
150 0.06
151 0.07
152 0.08
153 0.09
154 0.11
155 0.14
156 0.18
157 0.21
158 0.24
159 0.31
160 0.39
161 0.4
162 0.4
163 0.45
164 0.45
165 0.42
166 0.4
167 0.34
168 0.27
169 0.25
170 0.22
171 0.14
172 0.13
173 0.13
174 0.12