Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A010Q1G4

Protein Details
Accession A0A010Q1G4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
27-48SYYTWFRRRCCNQPERKMCREAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, plas 9, E.R. 4, mito 2
Family & Domain DBs
KEGG cfj:CFIO01_02442  -  
Amino Acid Sequences MQIRLRHLLLLLAVLLCLVDHAEANRSYYTWFRRRCCNQPERKMCREALVRWRYCNDAARRGGLPPVLCIVTKWWWERAHQACRPGIEGPSDWVDPDKPVLPKTEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.04
4 0.04
5 0.04
6 0.03
7 0.04
8 0.05
9 0.09
10 0.09
11 0.12
12 0.12
13 0.12
14 0.13
15 0.18
16 0.26
17 0.31
18 0.38
19 0.39
20 0.49
21 0.56
22 0.63
23 0.68
24 0.7
25 0.73
26 0.76
27 0.84
28 0.82
29 0.8
30 0.75
31 0.65
32 0.61
33 0.54
34 0.48
35 0.48
36 0.48
37 0.44
38 0.42
39 0.43
40 0.39
41 0.36
42 0.39
43 0.32
44 0.31
45 0.31
46 0.32
47 0.31
48 0.29
49 0.29
50 0.23
51 0.2
52 0.13
53 0.14
54 0.12
55 0.11
56 0.11
57 0.13
58 0.15
59 0.19
60 0.21
61 0.25
62 0.25
63 0.27
64 0.37
65 0.42
66 0.47
67 0.46
68 0.5
69 0.47
70 0.47
71 0.48
72 0.4
73 0.33
74 0.27
75 0.24
76 0.22
77 0.23
78 0.22
79 0.19
80 0.2
81 0.19
82 0.18
83 0.2
84 0.22
85 0.21
86 0.23