Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3K4B3

Protein Details
Accession J3K4B3    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-37WWKTSQCLRTSKKQKWNISVRGRLLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, mito_nucl 13.166, nucl 5.5, cyto_nucl 4.833
Family & Domain DBs
Gene Ontology GO:0016301  F:kinase activity  
GO:0016310  P:phosphorylation  
KEGG cim:CIMG_07872  -  
Amino Acid Sequences MSRFRRLGGTFIWWKTSQCLRTSKKQKWNISVRGRLLMTSVSSTGLAALASRRMASGEIQSCVISERPELDKFNKEVHLSRHIFTGRRIYLLRCDGVRPWIYRKSLHLSGTSSKEKHMFDNLLDGKGQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.43
4 0.39
5 0.37
6 0.46
7 0.46
8 0.57
9 0.66
10 0.7
11 0.72
12 0.78
13 0.8
14 0.8
15 0.85
16 0.84
17 0.83
18 0.81
19 0.73
20 0.68
21 0.59
22 0.49
23 0.4
24 0.31
25 0.23
26 0.16
27 0.14
28 0.1
29 0.09
30 0.09
31 0.08
32 0.07
33 0.06
34 0.05
35 0.05
36 0.05
37 0.06
38 0.06
39 0.06
40 0.06
41 0.07
42 0.08
43 0.12
44 0.12
45 0.13
46 0.13
47 0.13
48 0.13
49 0.13
50 0.13
51 0.08
52 0.07
53 0.09
54 0.11
55 0.13
56 0.15
57 0.18
58 0.21
59 0.23
60 0.25
61 0.26
62 0.24
63 0.26
64 0.28
65 0.34
66 0.32
67 0.3
68 0.32
69 0.32
70 0.31
71 0.3
72 0.35
73 0.27
74 0.28
75 0.29
76 0.25
77 0.3
78 0.32
79 0.32
80 0.24
81 0.25
82 0.23
83 0.28
84 0.31
85 0.28
86 0.3
87 0.35
88 0.36
89 0.37
90 0.41
91 0.43
92 0.44
93 0.43
94 0.41
95 0.38
96 0.42
97 0.46
98 0.48
99 0.41
100 0.39
101 0.42
102 0.4
103 0.4
104 0.41
105 0.36
106 0.3
107 0.4
108 0.39
109 0.35