Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A010RKU1

Protein Details
Accession A0A010RKU1   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
146-174DVKRKKAASASKKSKRKYRQLEEEKANSEHydrophilic
NLS Segment(s)
PositionSequence
148-163KRKKAASASKKSKRKY
Subcellular Location(s) mito 11, nucl 10, cyto_nucl 7, cyto 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
KEGG cfj:CFIO01_10080  -  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MPPPLPLLTRLPLQAGASNANAFMRRGPPAAASPALLSLSLPLPLVALFSTSPSASLKRHQMPPRPKPPPDSDIEESYLKGSGPGGQKINKTSSAVQLKHIPTGIVVKSQATRSRSQNRKIAREILAEKIDNLQNGDQSRSAIVGDVKRKKAASASKKSKRKYRQLEEEKANSEASEDRASEEAGQDETNGDPSSGEVKTFTADPSSAVQSKNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.22
4 0.2
5 0.2
6 0.18
7 0.18
8 0.17
9 0.15
10 0.16
11 0.17
12 0.18
13 0.19
14 0.19
15 0.2
16 0.22
17 0.26
18 0.23
19 0.21
20 0.19
21 0.18
22 0.18
23 0.15
24 0.12
25 0.09
26 0.09
27 0.09
28 0.08
29 0.07
30 0.07
31 0.07
32 0.07
33 0.06
34 0.06
35 0.06
36 0.07
37 0.08
38 0.08
39 0.09
40 0.1
41 0.13
42 0.14
43 0.19
44 0.26
45 0.31
46 0.4
47 0.47
48 0.55
49 0.63
50 0.72
51 0.78
52 0.77
53 0.73
54 0.71
55 0.7
56 0.65
57 0.59
58 0.57
59 0.49
60 0.44
61 0.44
62 0.38
63 0.32
64 0.27
65 0.23
66 0.15
67 0.12
68 0.09
69 0.11
70 0.13
71 0.16
72 0.19
73 0.21
74 0.23
75 0.26
76 0.28
77 0.25
78 0.24
79 0.23
80 0.27
81 0.32
82 0.31
83 0.3
84 0.34
85 0.34
86 0.32
87 0.31
88 0.23
89 0.16
90 0.19
91 0.17
92 0.11
93 0.11
94 0.11
95 0.12
96 0.15
97 0.19
98 0.18
99 0.22
100 0.28
101 0.38
102 0.45
103 0.49
104 0.53
105 0.55
106 0.58
107 0.57
108 0.55
109 0.48
110 0.46
111 0.42
112 0.4
113 0.36
114 0.3
115 0.27
116 0.25
117 0.23
118 0.18
119 0.18
120 0.14
121 0.14
122 0.15
123 0.17
124 0.14
125 0.13
126 0.13
127 0.12
128 0.11
129 0.09
130 0.11
131 0.15
132 0.23
133 0.3
134 0.32
135 0.34
136 0.34
137 0.34
138 0.38
139 0.43
140 0.45
141 0.49
142 0.58
143 0.65
144 0.74
145 0.8
146 0.83
147 0.83
148 0.83
149 0.83
150 0.83
151 0.84
152 0.86
153 0.89
154 0.86
155 0.82
156 0.74
157 0.65
158 0.54
159 0.43
160 0.34
161 0.26
162 0.22
163 0.18
164 0.16
165 0.16
166 0.17
167 0.17
168 0.17
169 0.16
170 0.14
171 0.12
172 0.12
173 0.11
174 0.11
175 0.11
176 0.13
177 0.12
178 0.1
179 0.09
180 0.1
181 0.14
182 0.13
183 0.13
184 0.11
185 0.12
186 0.13
187 0.14
188 0.14
189 0.13
190 0.13
191 0.15
192 0.18
193 0.23
194 0.25