Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A010RIB3

Protein Details
Accession A0A010RIB3   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
251-274HPDAHVGKTKRRNKKSTDTQDDELHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013785  Aldolase_TIM  
IPR040085  MJ0674-like  
IPR016431  Pyrv-formate_lyase-activ_prd  
IPR007197  rSAM  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0051536  F:iron-sulfur cluster binding  
GO:0046872  F:metal ion binding  
KEGG cfj:CFIO01_09103  -  
Amino Acid Sequences MSMLRRAITQRHDVFRRGMAGARRYLHLAPPFLLDDYTPRYMALTSIDESKKRSKAYAHLSKCNLCPRLCGVNRFETTGMCLIGNDTKVNVIAPHFGEEPCVQGHNGSGAVFFSGCNLRCVFCQNHDIAHQRNGQDLTPEELGECFDSLASLELLDGLVDIYLPDFKVWESATSKRLLKADDYAATARESIKAMHNQVGDLCFTGDGIAKSGLLVRHLVMPGKEKEGHRIMQFLAEEVSRDCFVNIMEQYHPDAHVGKTKRRNKKSTDTQDDELRYSEINRAVSGDEVSSVRKAAETAGLWRFCDPPRHDGFNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.54
3 0.51
4 0.43
5 0.41
6 0.39
7 0.4
8 0.42
9 0.41
10 0.39
11 0.39
12 0.39
13 0.4
14 0.38
15 0.35
16 0.29
17 0.3
18 0.3
19 0.27
20 0.26
21 0.19
22 0.18
23 0.22
24 0.23
25 0.2
26 0.18
27 0.19
28 0.18
29 0.19
30 0.18
31 0.15
32 0.14
33 0.22
34 0.25
35 0.26
36 0.3
37 0.37
38 0.39
39 0.38
40 0.4
41 0.38
42 0.43
43 0.53
44 0.59
45 0.58
46 0.61
47 0.65
48 0.65
49 0.65
50 0.65
51 0.6
52 0.49
53 0.45
54 0.42
55 0.48
56 0.47
57 0.47
58 0.43
59 0.46
60 0.47
61 0.47
62 0.42
63 0.31
64 0.31
65 0.27
66 0.23
67 0.14
68 0.13
69 0.11
70 0.14
71 0.14
72 0.12
73 0.1
74 0.1
75 0.1
76 0.1
77 0.1
78 0.08
79 0.1
80 0.1
81 0.13
82 0.14
83 0.13
84 0.16
85 0.15
86 0.16
87 0.14
88 0.14
89 0.11
90 0.1
91 0.11
92 0.09
93 0.09
94 0.08
95 0.07
96 0.06
97 0.06
98 0.06
99 0.06
100 0.06
101 0.1
102 0.1
103 0.12
104 0.12
105 0.13
106 0.13
107 0.18
108 0.18
109 0.17
110 0.21
111 0.2
112 0.21
113 0.24
114 0.28
115 0.25
116 0.29
117 0.3
118 0.26
119 0.29
120 0.28
121 0.24
122 0.22
123 0.2
124 0.18
125 0.15
126 0.14
127 0.11
128 0.1
129 0.11
130 0.09
131 0.08
132 0.05
133 0.04
134 0.04
135 0.04
136 0.05
137 0.04
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.02
145 0.02
146 0.02
147 0.02
148 0.02
149 0.03
150 0.03
151 0.03
152 0.03
153 0.03
154 0.05
155 0.06
156 0.09
157 0.11
158 0.14
159 0.17
160 0.2
161 0.21
162 0.22
163 0.24
164 0.22
165 0.2
166 0.21
167 0.21
168 0.19
169 0.2
170 0.18
171 0.18
172 0.17
173 0.16
174 0.13
175 0.12
176 0.1
177 0.1
178 0.13
179 0.16
180 0.18
181 0.22
182 0.21
183 0.2
184 0.21
185 0.2
186 0.16
187 0.13
188 0.11
189 0.07
190 0.07
191 0.07
192 0.08
193 0.07
194 0.08
195 0.08
196 0.07
197 0.08
198 0.1
199 0.1
200 0.09
201 0.1
202 0.09
203 0.12
204 0.13
205 0.14
206 0.13
207 0.18
208 0.19
209 0.23
210 0.27
211 0.25
212 0.31
213 0.34
214 0.37
215 0.32
216 0.33
217 0.28
218 0.28
219 0.27
220 0.21
221 0.18
222 0.14
223 0.14
224 0.12
225 0.15
226 0.11
227 0.11
228 0.1
229 0.1
230 0.1
231 0.15
232 0.15
233 0.15
234 0.15
235 0.16
236 0.19
237 0.2
238 0.2
239 0.16
240 0.17
241 0.16
242 0.23
243 0.26
244 0.32
245 0.42
246 0.51
247 0.61
248 0.69
249 0.76
250 0.77
251 0.83
252 0.86
253 0.86
254 0.87
255 0.83
256 0.77
257 0.77
258 0.71
259 0.61
260 0.51
261 0.41
262 0.31
263 0.26
264 0.27
265 0.23
266 0.21
267 0.2
268 0.2
269 0.2
270 0.2
271 0.19
272 0.15
273 0.12
274 0.12
275 0.14
276 0.14
277 0.14
278 0.12
279 0.12
280 0.12
281 0.11
282 0.16
283 0.15
284 0.21
285 0.28
286 0.3
287 0.3
288 0.32
289 0.34
290 0.32
291 0.4
292 0.38
293 0.4
294 0.46