Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A010QH57

Protein Details
Accession A0A010QH57   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MPRRAAPEPKPRKPQYSPEKRARIAHydrophilic
233-252PQPCDNKTPKSKTPHPHRGAHydrophilic
NLS Segment(s)
PositionSequence
9-13PKPRK
Subcellular Location(s) nucl 14, cyto_nucl 11, cyto 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
KEGG cfj:CFIO01_02017  -  
Amino Acid Sequences MPRRAAPEPKPRKPQYSPEKRARIAVLSELGMSLKEISIKEEVPVSSIKGIVTRYRLQQAGRDRPRPGRPRILSDRDVKTLLRVLQEKPACTYAELKRDAGVTCATKTLVRYLQMEGLKPTKPPAGDSEEEAERMRVLVEEGEGEEVTTTPIFTLLPLTNQQPFPLSPNPPRIPINIHNPPINKHQPPALPQRRRENLDPIHILPVNLLLLLLLLLVRFPLTYSRPTVPLPRPQPCDNKTPKSKTPHPHRGASDRVQEEPTITTAAHIRPQIQKERLELRHGSPVHGDKLLVGQAPFNHERHLASEVGHGIAAQPELETGVGGEAVEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.83
4 0.83
5 0.83
6 0.86
7 0.78
8 0.76
9 0.69
10 0.62
11 0.53
12 0.48
13 0.4
14 0.31
15 0.29
16 0.24
17 0.2
18 0.16
19 0.14
20 0.1
21 0.08
22 0.1
23 0.1
24 0.13
25 0.16
26 0.16
27 0.16
28 0.19
29 0.19
30 0.18
31 0.18
32 0.17
33 0.16
34 0.16
35 0.15
36 0.14
37 0.17
38 0.19
39 0.24
40 0.26
41 0.3
42 0.34
43 0.37
44 0.36
45 0.4
46 0.46
47 0.52
48 0.56
49 0.58
50 0.58
51 0.63
52 0.72
53 0.74
54 0.71
55 0.71
56 0.66
57 0.69
58 0.74
59 0.73
60 0.69
61 0.68
62 0.65
63 0.57
64 0.55
65 0.45
66 0.38
67 0.35
68 0.32
69 0.29
70 0.28
71 0.26
72 0.33
73 0.35
74 0.34
75 0.32
76 0.32
77 0.27
78 0.25
79 0.3
80 0.27
81 0.33
82 0.34
83 0.31
84 0.3
85 0.31
86 0.3
87 0.25
88 0.23
89 0.17
90 0.15
91 0.16
92 0.15
93 0.15
94 0.15
95 0.18
96 0.18
97 0.18
98 0.19
99 0.2
100 0.25
101 0.25
102 0.26
103 0.23
104 0.24
105 0.22
106 0.21
107 0.22
108 0.19
109 0.17
110 0.18
111 0.2
112 0.23
113 0.23
114 0.24
115 0.26
116 0.23
117 0.24
118 0.23
119 0.18
120 0.12
121 0.11
122 0.09
123 0.06
124 0.06
125 0.05
126 0.05
127 0.05
128 0.05
129 0.06
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.04
137 0.03
138 0.04
139 0.04
140 0.04
141 0.06
142 0.06
143 0.08
144 0.09
145 0.11
146 0.14
147 0.14
148 0.14
149 0.13
150 0.13
151 0.16
152 0.19
153 0.22
154 0.23
155 0.32
156 0.33
157 0.35
158 0.35
159 0.32
160 0.34
161 0.35
162 0.39
163 0.37
164 0.38
165 0.39
166 0.38
167 0.4
168 0.42
169 0.44
170 0.36
171 0.31
172 0.33
173 0.32
174 0.36
175 0.45
176 0.47
177 0.48
178 0.52
179 0.61
180 0.63
181 0.65
182 0.63
183 0.61
184 0.54
185 0.53
186 0.51
187 0.42
188 0.4
189 0.35
190 0.32
191 0.23
192 0.2
193 0.13
194 0.1
195 0.08
196 0.04
197 0.04
198 0.03
199 0.03
200 0.02
201 0.02
202 0.02
203 0.02
204 0.03
205 0.03
206 0.03
207 0.07
208 0.09
209 0.12
210 0.16
211 0.18
212 0.21
213 0.23
214 0.3
215 0.32
216 0.39
217 0.45
218 0.49
219 0.53
220 0.56
221 0.64
222 0.59
223 0.65
224 0.64
225 0.66
226 0.68
227 0.69
228 0.71
229 0.7
230 0.76
231 0.77
232 0.79
233 0.8
234 0.76
235 0.76
236 0.74
237 0.72
238 0.7
239 0.66
240 0.64
241 0.55
242 0.51
243 0.46
244 0.4
245 0.35
246 0.29
247 0.24
248 0.16
249 0.13
250 0.12
251 0.14
252 0.16
253 0.19
254 0.19
255 0.22
256 0.28
257 0.34
258 0.43
259 0.44
260 0.46
261 0.48
262 0.56
263 0.55
264 0.55
265 0.52
266 0.46
267 0.5
268 0.47
269 0.43
270 0.4
271 0.4
272 0.37
273 0.34
274 0.31
275 0.22
276 0.25
277 0.25
278 0.21
279 0.17
280 0.16
281 0.17
282 0.24
283 0.27
284 0.25
285 0.25
286 0.25
287 0.26
288 0.26
289 0.28
290 0.21
291 0.19
292 0.22
293 0.21
294 0.2
295 0.18
296 0.15
297 0.13
298 0.14
299 0.13
300 0.09
301 0.07
302 0.07
303 0.08
304 0.08
305 0.07
306 0.06
307 0.06
308 0.06