Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3K1N6

Protein Details
Accession J3K1N6    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
150-174AELLQQGTKKKKRKIKTSPWEGESGHydrophilic
NLS Segment(s)
PositionSequence
158-165KKKKRKIK
Subcellular Location(s) mito 18, nucl 8.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007763  NDUFA12  
Gene Ontology GO:0016020  C:membrane  
GO:0032981  P:mitochondrial respiratory chain complex I assembly  
KEGG cim:CIMG_09120  -  
Pfam View protein in Pfam  
PF05071  NDUFA12  
Amino Acid Sequences MSVNSLWFKWKSLRLPWRRFFLVGQDLAGNTFWEFKDAANSSRLRRIVKYNPKTHYADVKVSPQWHQWLRHVRPEPPSIAEQQQELVRQEQIKYLAKLADERWASKPSYLDKPQEQQSGPAIESRTPAYHTGPKPTAEQAGVRSAIGSEAELLQQGTKKKKRKIKTSPWEGESGAPGEKWQPEAWNPSAAKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.72
3 0.76
4 0.77
5 0.72
6 0.68
7 0.59
8 0.56
9 0.53
10 0.43
11 0.37
12 0.31
13 0.27
14 0.26
15 0.25
16 0.17
17 0.1
18 0.12
19 0.1
20 0.11
21 0.11
22 0.1
23 0.18
24 0.19
25 0.21
26 0.24
27 0.27
28 0.28
29 0.35
30 0.38
31 0.33
32 0.35
33 0.41
34 0.46
35 0.54
36 0.61
37 0.62
38 0.62
39 0.66
40 0.66
41 0.61
42 0.59
43 0.52
44 0.48
45 0.42
46 0.43
47 0.4
48 0.38
49 0.37
50 0.31
51 0.34
52 0.34
53 0.34
54 0.36
55 0.44
56 0.46
57 0.53
58 0.53
59 0.5
60 0.51
61 0.51
62 0.45
63 0.38
64 0.36
65 0.3
66 0.29
67 0.26
68 0.2
69 0.19
70 0.18
71 0.17
72 0.17
73 0.15
74 0.14
75 0.15
76 0.15
77 0.15
78 0.18
79 0.19
80 0.18
81 0.18
82 0.17
83 0.17
84 0.18
85 0.16
86 0.19
87 0.16
88 0.18
89 0.2
90 0.21
91 0.21
92 0.21
93 0.23
94 0.21
95 0.28
96 0.3
97 0.32
98 0.33
99 0.37
100 0.41
101 0.43
102 0.39
103 0.33
104 0.32
105 0.29
106 0.26
107 0.24
108 0.2
109 0.16
110 0.17
111 0.17
112 0.15
113 0.15
114 0.16
115 0.17
116 0.25
117 0.25
118 0.32
119 0.32
120 0.33
121 0.33
122 0.34
123 0.32
124 0.25
125 0.25
126 0.21
127 0.22
128 0.21
129 0.19
130 0.17
131 0.14
132 0.13
133 0.12
134 0.09
135 0.06
136 0.06
137 0.06
138 0.07
139 0.07
140 0.08
141 0.11
142 0.17
143 0.26
144 0.35
145 0.44
146 0.53
147 0.62
148 0.71
149 0.79
150 0.84
151 0.86
152 0.88
153 0.9
154 0.9
155 0.84
156 0.77
157 0.67
158 0.58
159 0.49
160 0.4
161 0.3
162 0.21
163 0.18
164 0.18
165 0.19
166 0.2
167 0.19
168 0.21
169 0.25
170 0.32
171 0.34
172 0.38