Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A010QWB5

Protein Details
Accession A0A010QWB5   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
18-37FENNRKWAEEKKKQDPNFFVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 16.5, cyto_nucl 12, pero 6, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001765  Carbonic_anhydrase  
IPR015892  Carbonic_anhydrase_CS  
IPR036874  Carbonic_anhydrase_sf  
Gene Ontology GO:0004089  F:carbonate dehydratase activity  
GO:0008270  F:zinc ion binding  
GO:0015976  P:carbon utilization  
KEGG cfj:CFIO01_02782  -  
Pfam View protein in Pfam  
PF00484  Pro_CA  
PROSITE View protein in PROSITE  
PS00704  PROK_CO2_ANHYDRASE_1  
CDD cd00883  beta_CA_cladeA  
Amino Acid Sequences MAESDIEKYLKQTHDRVFENNRKWAEEKKKQDPNFFVSLSQGQAPEYLWIGCSDSRIPAEQITGLEPGEAFIHRNIANMVNNIDLNVMSVINYAVRHLKVKHIVVCGHYGCGGVKAAMTPKDLGLLNPWLRNIRDVYRLHEAELDAIKEEDARYDRLVELNVLEQCRNVIKTAAIQQSYAKNKFPIVHGWVFGFNDGLLKDLEIDHEKMLHDVQKLYHLPGADF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.52
3 0.56
4 0.6
5 0.64
6 0.65
7 0.65
8 0.6
9 0.56
10 0.56
11 0.59
12 0.59
13 0.6
14 0.63
15 0.66
16 0.73
17 0.75
18 0.81
19 0.77
20 0.72
21 0.67
22 0.58
23 0.48
24 0.41
25 0.37
26 0.3
27 0.26
28 0.2
29 0.15
30 0.15
31 0.15
32 0.12
33 0.11
34 0.1
35 0.09
36 0.09
37 0.11
38 0.1
39 0.12
40 0.11
41 0.13
42 0.14
43 0.15
44 0.16
45 0.14
46 0.15
47 0.14
48 0.14
49 0.13
50 0.13
51 0.11
52 0.1
53 0.09
54 0.08
55 0.08
56 0.08
57 0.07
58 0.07
59 0.11
60 0.11
61 0.11
62 0.12
63 0.14
64 0.15
65 0.15
66 0.16
67 0.13
68 0.13
69 0.13
70 0.12
71 0.08
72 0.07
73 0.07
74 0.06
75 0.04
76 0.05
77 0.05
78 0.05
79 0.05
80 0.06
81 0.08
82 0.09
83 0.11
84 0.12
85 0.17
86 0.21
87 0.24
88 0.27
89 0.27
90 0.27
91 0.26
92 0.29
93 0.25
94 0.2
95 0.17
96 0.14
97 0.11
98 0.11
99 0.09
100 0.05
101 0.05
102 0.05
103 0.07
104 0.08
105 0.09
106 0.09
107 0.09
108 0.11
109 0.11
110 0.11
111 0.11
112 0.16
113 0.17
114 0.17
115 0.18
116 0.18
117 0.18
118 0.2
119 0.2
120 0.17
121 0.23
122 0.24
123 0.27
124 0.32
125 0.32
126 0.31
127 0.3
128 0.27
129 0.22
130 0.22
131 0.18
132 0.11
133 0.11
134 0.1
135 0.09
136 0.09
137 0.09
138 0.1
139 0.12
140 0.12
141 0.13
142 0.14
143 0.14
144 0.15
145 0.12
146 0.11
147 0.13
148 0.15
149 0.15
150 0.15
151 0.13
152 0.14
153 0.16
154 0.16
155 0.13
156 0.12
157 0.11
158 0.15
159 0.23
160 0.28
161 0.26
162 0.26
163 0.29
164 0.36
165 0.43
166 0.42
167 0.37
168 0.32
169 0.35
170 0.36
171 0.36
172 0.34
173 0.33
174 0.33
175 0.32
176 0.32
177 0.31
178 0.29
179 0.27
180 0.2
181 0.14
182 0.13
183 0.12
184 0.11
185 0.09
186 0.08
187 0.09
188 0.09
189 0.13
190 0.15
191 0.16
192 0.16
193 0.18
194 0.18
195 0.19
196 0.21
197 0.22
198 0.21
199 0.21
200 0.22
201 0.28
202 0.3
203 0.31
204 0.3