Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E1RV80

Protein Details
Accession A0A0E1RV80    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
52-73KGEDCKASSRRKKMTKRFSVETHydrophilic
NLS Segment(s)
PositionSequence
61-64RRKK
Subcellular Location(s) nucl 17, mito 5, cyto 4
Family & Domain DBs
KEGG cim:CIMG_08073  -  
Amino Acid Sequences MLKYQVVAGRAKQYQDKSKSLNEMQIKEDGGSPKSLESGRDGTKKSQAAKQKGEDCKASSRRKKMTKRFSVETLRQGVYDNDFIGHASRTGQGTVRQKRVLETTQHLEQLEQVLWGSRTAERTAHLIFCAVKLKGEGPKGTGRDTKLKMRIFIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.53
3 0.56
4 0.53
5 0.56
6 0.61
7 0.57
8 0.58
9 0.54
10 0.5
11 0.47
12 0.45
13 0.4
14 0.33
15 0.34
16 0.28
17 0.23
18 0.21
19 0.19
20 0.16
21 0.19
22 0.19
23 0.16
24 0.17
25 0.21
26 0.25
27 0.3
28 0.32
29 0.32
30 0.38
31 0.41
32 0.4
33 0.41
34 0.45
35 0.47
36 0.51
37 0.55
38 0.57
39 0.59
40 0.59
41 0.55
42 0.49
43 0.5
44 0.53
45 0.56
46 0.56
47 0.58
48 0.64
49 0.71
50 0.79
51 0.8
52 0.82
53 0.82
54 0.81
55 0.76
56 0.74
57 0.71
58 0.65
59 0.59
60 0.52
61 0.42
62 0.35
63 0.32
64 0.26
65 0.21
66 0.17
67 0.12
68 0.09
69 0.08
70 0.08
71 0.08
72 0.08
73 0.06
74 0.06
75 0.08
76 0.08
77 0.09
78 0.1
79 0.15
80 0.25
81 0.31
82 0.36
83 0.37
84 0.36
85 0.38
86 0.41
87 0.39
88 0.35
89 0.33
90 0.33
91 0.33
92 0.35
93 0.33
94 0.28
95 0.25
96 0.22
97 0.17
98 0.12
99 0.09
100 0.09
101 0.09
102 0.1
103 0.11
104 0.1
105 0.13
106 0.14
107 0.15
108 0.15
109 0.18
110 0.2
111 0.19
112 0.17
113 0.17
114 0.16
115 0.17
116 0.21
117 0.18
118 0.16
119 0.17
120 0.2
121 0.24
122 0.29
123 0.28
124 0.27
125 0.34
126 0.36
127 0.4
128 0.42
129 0.41
130 0.45
131 0.49
132 0.55
133 0.56
134 0.58