Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A010REC5

Protein Details
Accession A0A010REC5   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
405-432EVDVMRVNRRRNNHRQPQQIRPRRQIILHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 6.5, cyto_nucl 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008927  6-PGluconate_DH-like_C_sf  
IPR036291  NAD(P)-bd_dom_sf  
IPR017476  UDP-Glc/GDP-Man  
IPR014026  UDP-Glc/GDP-Man_DH_dimer  
IPR001732  UDP-Glc/GDP-Man_DH_N  
IPR028359  UDP_ManNAc/GlcNAc_DH  
Gene Ontology GO:0051287  F:NAD binding  
GO:0016628  F:oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor  
GO:0016616  F:oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor  
GO:0000271  P:polysaccharide biosynthetic process  
KEGG cfj:CFIO01_07999  -  
Pfam View protein in Pfam  
PF00984  UDPG_MGDP_dh  
PF03721  UDPG_MGDP_dh_N  
Amino Acid Sequences MRVTIDKPSFHNRSLSVPAPPTPPPEALGLNLPGFDTFKANFDLPLTPVTPPPEYKEHPFSHNDRVLDLSPIVDPNDQPLVAVIGVGYVGTHLVESFSAHYNVLGFDVSEKRISEIREELPSDRIRFTTSKTDLHEATHFLISVPTLLKADKSIETSYLQSAIATVAQHARPGSTVVIESSVAVGMTRSLLGPIATAHGFYAGMSPERVDPGRIEPPCHAIPKIVSGLDDEIPGSLASVMRLYNQVFDRLVPVSRTEVAEMMKLYENCQRMMCIAFANEMADACIPHGIDPYEVAAAAASKPFGYMPYTPSLGVGGHCIPVNPYYLLSNSAFPLLEAAAEKMAARPAAIARRAIDSLTRDAKAGAASALVRPRVLVVGVGFKAGQSVLSNSPGVDLVKAFVRSGEVDVMRVNRRRNNHRQPQQIRPRRQIILTQDLSIRRVDPEDKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.46
3 0.42
4 0.4
5 0.41
6 0.4
7 0.41
8 0.4
9 0.37
10 0.36
11 0.31
12 0.31
13 0.29
14 0.26
15 0.28
16 0.26
17 0.22
18 0.21
19 0.19
20 0.17
21 0.17
22 0.16
23 0.15
24 0.13
25 0.15
26 0.18
27 0.18
28 0.18
29 0.19
30 0.21
31 0.18
32 0.21
33 0.2
34 0.18
35 0.2
36 0.24
37 0.25
38 0.25
39 0.28
40 0.33
41 0.36
42 0.42
43 0.47
44 0.47
45 0.49
46 0.54
47 0.53
48 0.56
49 0.57
50 0.5
51 0.42
52 0.43
53 0.39
54 0.34
55 0.29
56 0.2
57 0.16
58 0.17
59 0.18
60 0.15
61 0.14
62 0.15
63 0.18
64 0.16
65 0.15
66 0.14
67 0.14
68 0.12
69 0.12
70 0.08
71 0.05
72 0.05
73 0.05
74 0.04
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.04
81 0.04
82 0.05
83 0.08
84 0.1
85 0.11
86 0.11
87 0.12
88 0.12
89 0.12
90 0.11
91 0.09
92 0.06
93 0.09
94 0.11
95 0.13
96 0.14
97 0.14
98 0.15
99 0.19
100 0.2
101 0.2
102 0.23
103 0.24
104 0.26
105 0.28
106 0.28
107 0.31
108 0.34
109 0.32
110 0.29
111 0.26
112 0.26
113 0.25
114 0.28
115 0.31
116 0.31
117 0.34
118 0.36
119 0.39
120 0.36
121 0.37
122 0.35
123 0.27
124 0.26
125 0.22
126 0.19
127 0.15
128 0.14
129 0.11
130 0.11
131 0.09
132 0.08
133 0.08
134 0.08
135 0.08
136 0.09
137 0.12
138 0.12
139 0.14
140 0.15
141 0.16
142 0.17
143 0.18
144 0.18
145 0.16
146 0.14
147 0.11
148 0.1
149 0.09
150 0.09
151 0.07
152 0.07
153 0.1
154 0.1
155 0.11
156 0.11
157 0.11
158 0.1
159 0.11
160 0.11
161 0.08
162 0.08
163 0.07
164 0.08
165 0.08
166 0.07
167 0.06
168 0.06
169 0.05
170 0.05
171 0.04
172 0.03
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.05
181 0.06
182 0.06
183 0.06
184 0.06
185 0.06
186 0.06
187 0.06
188 0.07
189 0.05
190 0.06
191 0.06
192 0.07
193 0.07
194 0.08
195 0.09
196 0.08
197 0.09
198 0.12
199 0.19
200 0.19
201 0.2
202 0.2
203 0.24
204 0.26
205 0.26
206 0.23
207 0.17
208 0.16
209 0.18
210 0.18
211 0.13
212 0.11
213 0.1
214 0.12
215 0.11
216 0.11
217 0.08
218 0.07
219 0.07
220 0.06
221 0.06
222 0.04
223 0.04
224 0.04
225 0.05
226 0.05
227 0.05
228 0.07
229 0.07
230 0.11
231 0.11
232 0.13
233 0.12
234 0.13
235 0.14
236 0.13
237 0.14
238 0.11
239 0.11
240 0.11
241 0.13
242 0.13
243 0.12
244 0.12
245 0.12
246 0.12
247 0.11
248 0.11
249 0.13
250 0.13
251 0.14
252 0.18
253 0.19
254 0.19
255 0.19
256 0.17
257 0.15
258 0.16
259 0.15
260 0.1
261 0.09
262 0.09
263 0.09
264 0.09
265 0.08
266 0.07
267 0.06
268 0.06
269 0.05
270 0.05
271 0.06
272 0.05
273 0.05
274 0.07
275 0.07
276 0.07
277 0.07
278 0.08
279 0.07
280 0.07
281 0.07
282 0.05
283 0.05
284 0.06
285 0.06
286 0.05
287 0.05
288 0.05
289 0.05
290 0.06
291 0.09
292 0.1
293 0.12
294 0.16
295 0.17
296 0.17
297 0.17
298 0.17
299 0.14
300 0.13
301 0.13
302 0.1
303 0.1
304 0.1
305 0.1
306 0.11
307 0.11
308 0.13
309 0.11
310 0.11
311 0.11
312 0.12
313 0.15
314 0.15
315 0.15
316 0.14
317 0.14
318 0.13
319 0.12
320 0.12
321 0.09
322 0.08
323 0.08
324 0.08
325 0.07
326 0.07
327 0.07
328 0.07
329 0.09
330 0.08
331 0.08
332 0.09
333 0.12
334 0.19
335 0.21
336 0.22
337 0.21
338 0.25
339 0.25
340 0.24
341 0.24
342 0.21
343 0.25
344 0.28
345 0.27
346 0.24
347 0.24
348 0.25
349 0.21
350 0.19
351 0.12
352 0.09
353 0.09
354 0.12
355 0.16
356 0.16
357 0.15
358 0.15
359 0.15
360 0.15
361 0.14
362 0.12
363 0.09
364 0.15
365 0.15
366 0.16
367 0.15
368 0.14
369 0.14
370 0.13
371 0.13
372 0.08
373 0.11
374 0.13
375 0.16
376 0.17
377 0.16
378 0.17
379 0.17
380 0.16
381 0.14
382 0.11
383 0.1
384 0.14
385 0.15
386 0.14
387 0.13
388 0.15
389 0.15
390 0.17
391 0.22
392 0.18
393 0.18
394 0.21
395 0.26
396 0.32
397 0.36
398 0.41
399 0.41
400 0.51
401 0.6
402 0.68
403 0.74
404 0.78
405 0.82
406 0.86
407 0.88
408 0.9
409 0.91
410 0.9
411 0.89
412 0.87
413 0.85
414 0.79
415 0.74
416 0.71
417 0.68
418 0.67
419 0.6
420 0.53
421 0.5
422 0.48
423 0.46
424 0.4
425 0.33
426 0.25
427 0.27