FuNGI

A0A010REC5

Protein Details

Accession

A0A010REC5

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
405-432	EVDVMRVNRRRNNHRQPQQIRPRRQIIL	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 15, nucl 6.5, cyto_nucl 6, cyto 4.5

Family & Domain DBs

InterPro	View protein in InterPro IPR008927 6-PGluconate_DH-like_C_sf IPR036291 NAD(P)-bd_dom_sf IPR017476 UDP-Glc/GDP-Man IPR014026 UDP-Glc/GDP-Man_DH_dimer IPR001732 UDP-Glc/GDP-Man_DH_N IPR028359 UDP_ManNAc/GlcNAc_DH
Gene Ontology	GO:0051287 F:NAD binding GO:0016628 F:oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor GO:0016616 F:oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor GO:0000271 P:polysaccharide biosynthetic process
KEGG	cfj:CFIO01_07999 -
Pfam	View protein in Pfam PF00984 UDPG_MGDP_dh PF03721 UDPG_MGDP_dh_N

Amino Acid Sequences

MRVTIDKPSFHNRSLSVPAPPTPPPEALGLNLPGFDTFKANFDLPLTPVTPPPEYKEHPFSHNDRVLDLSPIVDPNDQPLVAVIGVGYVGTHLVESFSAHYNVLGFDVSEKRISEIREELPSDRIRFTTSKTDLHEATHFLISVPTLLKADKSIETSYLQSAIATVAQHARPGSTVVIESSVAVGMTRSLLGPIATAHGFYAGMSPERVDPGRIEPPCHAIPKIVSGLDDEIPGSLASVMRLYNQVFDRLVPVSRTEVAEMMKLYENCQRMMCIAFANEMADACIPHGIDPYEVAAAAASKPFGYMPYTPSLGVGGHCIPVNPYYLLSNSAFPLLEAAAEKMAARPAAIARRAIDSLTRDAKAGAASALVRPRVLVVGVGFKAGQSVLSNSPGVDLVKAFVRSGEVDVMRVNRRRNNHRQPQQIRPRRQIILTQDLSIRRVDPEDKR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.48
2	0.46
3	0.42
4	0.4
5	0.41
6	0.4
7	0.41
8	0.4
9	0.37
10	0.36
11	0.31
12	0.31
13	0.29
14	0.26
15	0.28
16	0.26
17	0.22
18	0.21
19	0.19
20	0.17
21	0.17
22	0.16
23	0.15
24	0.13
25	0.15
26	0.18
27	0.18
28	0.18
29	0.19
30	0.21
31	0.18
32	0.21
33	0.2
34	0.18
35	0.2
36	0.24
37	0.25
38	0.25
39	0.28
40	0.33
41	0.36
42	0.42
43	0.47
44	0.47
45	0.49
46	0.54
47	0.53
48	0.56
49	0.57
50	0.5
51	0.42
52	0.43
53	0.39
54	0.34
55	0.29
56	0.2
57	0.16
58	0.17
59	0.18
60	0.15
61	0.14
62	0.15
63	0.18
64	0.16
65	0.15
66	0.14
67	0.14
68	0.12
69	0.12
70	0.08
71	0.05
72	0.05
73	0.05
74	0.04
75	0.03
76	0.03
77	0.03
78	0.03
79	0.03
80	0.04
81	0.04
82	0.05
83	0.08
84	0.1
85	0.11
86	0.11
87	0.12
88	0.12
89	0.12
90	0.11
91	0.09
92	0.06
93	0.09
94	0.11
95	0.13
96	0.14
97	0.14
98	0.15
99	0.19
100	0.2
101	0.2
102	0.23
103	0.24
104	0.26
105	0.28
106	0.28
107	0.31
108	0.34
109	0.32
110	0.29
111	0.26
112	0.26
113	0.25
114	0.28
115	0.31
116	0.31
117	0.34
118	0.36
119	0.39
120	0.36
121	0.37
122	0.35
123	0.27
124	0.26
125	0.22
126	0.19
127	0.15
128	0.14
129	0.11
130	0.11
131	0.09
132	0.08
133	0.08
134	0.08
135	0.08
136	0.09
137	0.12
138	0.12
139	0.14
140	0.15
141	0.16
142	0.17
143	0.18
144	0.18
145	0.16
146	0.14
147	0.11
148	0.1
149	0.09
150	0.09
151	0.07
152	0.07
153	0.1
154	0.1
155	0.11
156	0.11
157	0.11
158	0.1
159	0.11
160	0.11
161	0.08
162	0.08
163	0.07
164	0.08
165	0.08
166	0.07
167	0.06
168	0.06
169	0.05
170	0.05
171	0.04
172	0.03
173	0.04
174	0.04
175	0.04
176	0.04
177	0.04
178	0.04
179	0.04
180	0.05
181	0.06
182	0.06
183	0.06
184	0.06
185	0.06
186	0.06
187	0.06
188	0.07
189	0.05
190	0.06
191	0.06
192	0.07
193	0.07
194	0.08
195	0.09
196	0.08
197	0.09
198	0.12
199	0.19
200	0.19
201	0.2
202	0.2
203	0.24
204	0.26
205	0.26
206	0.23
207	0.17
208	0.16
209	0.18
210	0.18
211	0.13
212	0.11
213	0.1
214	0.12
215	0.11
216	0.11
217	0.08
218	0.07
219	0.07
220	0.06
221	0.06
222	0.04
223	0.04
224	0.04
225	0.05
226	0.05
227	0.05
228	0.07
229	0.07
230	0.11
231	0.11
232	0.13
233	0.12
234	0.13
235	0.14
236	0.13
237	0.14
238	0.11
239	0.11
240	0.11
241	0.13
242	0.13
243	0.12
244	0.12
245	0.12
246	0.12
247	0.11
248	0.11
249	0.13
250	0.13
251	0.14
252	0.18
253	0.19
254	0.19
255	0.19
256	0.17
257	0.15
258	0.16
259	0.15
260	0.1
261	0.09
262	0.09
263	0.09
264	0.09
265	0.08
266	0.07
267	0.06
268	0.06
269	0.05
270	0.05
271	0.06
272	0.05
273	0.05
274	0.07
275	0.07
276	0.07
277	0.07
278	0.08
279	0.07
280	0.07
281	0.07
282	0.05
283	0.05
284	0.06
285	0.06
286	0.05
287	0.05
288	0.05
289	0.05
290	0.06
291	0.09
292	0.1
293	0.12
294	0.16
295	0.17
296	0.17
297	0.17
298	0.17
299	0.14
300	0.13
301	0.13
302	0.1
303	0.1
304	0.1
305	0.1
306	0.11
307	0.11
308	0.13
309	0.11
310	0.11
311	0.11
312	0.12
313	0.15
314	0.15
315	0.15
316	0.14
317	0.14
318	0.13
319	0.12
320	0.12
321	0.09
322	0.08
323	0.08
324	0.08
325	0.07
326	0.07
327	0.07
328	0.07
329	0.09
330	0.08
331	0.08
332	0.09
333	0.12
334	0.19
335	0.21
336	0.22
337	0.21
338	0.25
339	0.25
340	0.24
341	0.24
342	0.21
343	0.25
344	0.28
345	0.27
346	0.24
347	0.24
348	0.25
349	0.21
350	0.19
351	0.12
352	0.09
353	0.09
354	0.12
355	0.16
356	0.16
357	0.15
358	0.15
359	0.15
360	0.15
361	0.14
362	0.12
363	0.09
364	0.15
365	0.15
366	0.16
367	0.15
368	0.14
369	0.14
370	0.13
371	0.13
372	0.08
373	0.11
374	0.13
375	0.16
376	0.17
377	0.16
378	0.17
379	0.17
380	0.16
381	0.14
382	0.11
383	0.1
384	0.14
385	0.15
386	0.14
387	0.13
388	0.15
389	0.15
390	0.17
391	0.22
392	0.18
393	0.18
394	0.21
395	0.26
396	0.32
397	0.36
398	0.41
399	0.41
400	0.51
401	0.6
402	0.68
403	0.74
404	0.78
405	0.82
406	0.86
407	0.88
408	0.9
409	0.91
410	0.9
411	0.89
412	0.87
413	0.85
414	0.79
415	0.74
416	0.71
417	0.68
418	0.67
419	0.6
420	0.53
421	0.5
422	0.48
423	0.46
424	0.4
425	0.33
426	0.25
427	0.27

A0A010REC5

3D AlphaFold-predicted Structure Viewer