Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A010R2A9

Protein Details
Accession A0A010R2A9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
63-84PSEADRKKGAKRPARPSRPTKCBasic
NLS Segment(s)
PositionSequence
68-81RKKGAKRPARPSRP
Subcellular Location(s) extr 12, mito 9, pero 2, E.R. 2
Family & Domain DBs
KEGG cfj:CFIO01_01245  -  
Amino Acid Sequences MKTTSLFLLVTLVSSGFALSIPSRLSSSLDSRSEVHNAIAPEDILNPVVRPRECEEPAEPEEPSEADRKKGAKRPARPSRPTKC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.05
5 0.06
6 0.06
7 0.07
8 0.08
9 0.09
10 0.1
11 0.1
12 0.12
13 0.13
14 0.17
15 0.21
16 0.21
17 0.22
18 0.23
19 0.24
20 0.24
21 0.22
22 0.19
23 0.16
24 0.15
25 0.14
26 0.13
27 0.11
28 0.09
29 0.08
30 0.08
31 0.06
32 0.06
33 0.05
34 0.07
35 0.11
36 0.11
37 0.14
38 0.17
39 0.24
40 0.25
41 0.29
42 0.29
43 0.31
44 0.35
45 0.33
46 0.3
47 0.22
48 0.22
49 0.19
50 0.19
51 0.2
52 0.17
53 0.18
54 0.22
55 0.27
56 0.34
57 0.42
58 0.51
59 0.54
60 0.63
61 0.71
62 0.79
63 0.84
64 0.86