Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3K4X9

Protein Details
Accession J3K4X9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
35-60YIELTDRRSRSRQPRGCRKLGLKSCSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, golg 4, plas 3, E.R. 3, mito 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR005302  MoCF_Sase_C  
IPR005303  MOCOS_middle  
Gene Ontology GO:0016020  C:membrane  
GO:0003824  F:catalytic activity  
GO:0030151  F:molybdenum ion binding  
GO:0030170  F:pyridoxal phosphate binding  
KEGG cim:CIMG_08155  -  
Pfam View protein in Pfam  
PF03473  MOSC  
PF03476  MOSC_N  
PROSITE View protein in PROSITE  
PS51340  MOSC  
Amino Acid Sequences MLRLTGVIPRFGLTVSVSLPIVYFICVAPLAFLLYIELTDRRSRSRQPRGCRKLGLKSCSNLADEHSYNTRGVHKRSKDDAGKKIRVKALIVYPIKSCAGVEFNFIDGTDTGLMYDRQFAFAEYVETRNAEGEPKTNGSAEKNATTGRWDCRTLRDGKFSRMALVRPEIWIPDPSLPSYSPKAPAVRSKGVLVINYPRIATSFLTKLGMKLNLCSREESFQVPLYPPDGEYPSIPFRIFRDTPNAYNYGDHIPSSLATFLGSTKPLSLFRVDPDHYRPVRGNAPPAADLGFEPTMGFPDEYPVQMQNLASIRNIAEQVQYAIPKFSVRRFRPNIVLEGLEAYDEDDWKRIRIVQGPRSRKAPPSSAEGDQDDEHKDEGKGVDVIVACRTVRCRLPNVDPDTGERHQVEPDKTLRSMRNIDAGAGKSGCLGMMLVPVARKFTLHVGDEIEVRERGEHFYVKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.14
4 0.13
5 0.13
6 0.13
7 0.12
8 0.12
9 0.1
10 0.1
11 0.08
12 0.09
13 0.1
14 0.09
15 0.09
16 0.09
17 0.09
18 0.08
19 0.08
20 0.07
21 0.07
22 0.08
23 0.09
24 0.1
25 0.12
26 0.17
27 0.2
28 0.25
29 0.31
30 0.41
31 0.5
32 0.6
33 0.66
34 0.72
35 0.81
36 0.84
37 0.86
38 0.85
39 0.82
40 0.81
41 0.81
42 0.78
43 0.73
44 0.66
45 0.63
46 0.58
47 0.52
48 0.41
49 0.36
50 0.35
51 0.3
52 0.31
53 0.3
54 0.28
55 0.27
56 0.29
57 0.34
58 0.33
59 0.39
60 0.45
61 0.48
62 0.54
63 0.6
64 0.67
65 0.68
66 0.7
67 0.73
68 0.74
69 0.76
70 0.73
71 0.75
72 0.69
73 0.62
74 0.55
75 0.51
76 0.47
77 0.47
78 0.45
79 0.39
80 0.36
81 0.36
82 0.35
83 0.29
84 0.22
85 0.15
86 0.17
87 0.15
88 0.18
89 0.16
90 0.16
91 0.16
92 0.16
93 0.15
94 0.11
95 0.12
96 0.1
97 0.09
98 0.08
99 0.09
100 0.1
101 0.09
102 0.14
103 0.12
104 0.14
105 0.14
106 0.14
107 0.14
108 0.14
109 0.17
110 0.13
111 0.14
112 0.13
113 0.14
114 0.13
115 0.13
116 0.13
117 0.13
118 0.12
119 0.13
120 0.15
121 0.17
122 0.18
123 0.18
124 0.19
125 0.19
126 0.23
127 0.23
128 0.21
129 0.21
130 0.2
131 0.19
132 0.22
133 0.23
134 0.23
135 0.24
136 0.26
137 0.26
138 0.31
139 0.36
140 0.4
141 0.4
142 0.45
143 0.44
144 0.46
145 0.5
146 0.44
147 0.43
148 0.38
149 0.36
150 0.29
151 0.29
152 0.26
153 0.21
154 0.21
155 0.18
156 0.17
157 0.17
158 0.15
159 0.15
160 0.16
161 0.15
162 0.17
163 0.16
164 0.18
165 0.2
166 0.2
167 0.2
168 0.22
169 0.24
170 0.25
171 0.31
172 0.34
173 0.35
174 0.34
175 0.32
176 0.33
177 0.31
178 0.29
179 0.24
180 0.22
181 0.21
182 0.21
183 0.2
184 0.15
185 0.15
186 0.16
187 0.14
188 0.12
189 0.11
190 0.11
191 0.13
192 0.13
193 0.14
194 0.15
195 0.18
196 0.15
197 0.16
198 0.21
199 0.24
200 0.25
201 0.25
202 0.24
203 0.22
204 0.24
205 0.23
206 0.19
207 0.15
208 0.16
209 0.14
210 0.14
211 0.13
212 0.12
213 0.1
214 0.1
215 0.1
216 0.1
217 0.1
218 0.12
219 0.13
220 0.14
221 0.14
222 0.13
223 0.13
224 0.19
225 0.2
226 0.19
227 0.24
228 0.26
229 0.28
230 0.3
231 0.3
232 0.24
233 0.23
234 0.23
235 0.19
236 0.16
237 0.14
238 0.12
239 0.1
240 0.1
241 0.1
242 0.09
243 0.05
244 0.05
245 0.05
246 0.06
247 0.07
248 0.07
249 0.07
250 0.08
251 0.09
252 0.1
253 0.11
254 0.13
255 0.12
256 0.14
257 0.2
258 0.2
259 0.21
260 0.25
261 0.33
262 0.31
263 0.33
264 0.32
265 0.3
266 0.35
267 0.34
268 0.34
269 0.28
270 0.3
271 0.28
272 0.27
273 0.23
274 0.17
275 0.15
276 0.14
277 0.12
278 0.09
279 0.09
280 0.08
281 0.09
282 0.1
283 0.1
284 0.06
285 0.09
286 0.1
287 0.1
288 0.11
289 0.11
290 0.11
291 0.12
292 0.12
293 0.12
294 0.13
295 0.13
296 0.12
297 0.13
298 0.13
299 0.13
300 0.14
301 0.11
302 0.1
303 0.1
304 0.12
305 0.13
306 0.13
307 0.12
308 0.12
309 0.12
310 0.14
311 0.16
312 0.21
313 0.29
314 0.33
315 0.43
316 0.48
317 0.53
318 0.58
319 0.59
320 0.55
321 0.47
322 0.43
323 0.33
324 0.28
325 0.23
326 0.15
327 0.12
328 0.09
329 0.07
330 0.08
331 0.08
332 0.1
333 0.11
334 0.12
335 0.13
336 0.15
337 0.18
338 0.25
339 0.34
340 0.4
341 0.5
342 0.57
343 0.59
344 0.61
345 0.61
346 0.6
347 0.56
348 0.54
349 0.46
350 0.46
351 0.47
352 0.46
353 0.46
354 0.41
355 0.38
356 0.31
357 0.31
358 0.25
359 0.22
360 0.2
361 0.18
362 0.17
363 0.16
364 0.16
365 0.16
366 0.14
367 0.13
368 0.16
369 0.15
370 0.16
371 0.14
372 0.16
373 0.13
374 0.15
375 0.17
376 0.19
377 0.24
378 0.28
379 0.33
380 0.38
381 0.46
382 0.53
383 0.58
384 0.58
385 0.53
386 0.53
387 0.53
388 0.47
389 0.44
390 0.37
391 0.31
392 0.32
393 0.37
394 0.36
395 0.35
396 0.38
397 0.38
398 0.38
399 0.44
400 0.42
401 0.43
402 0.46
403 0.43
404 0.45
405 0.41
406 0.41
407 0.4
408 0.37
409 0.34
410 0.29
411 0.26
412 0.19
413 0.18
414 0.16
415 0.11
416 0.09
417 0.06
418 0.08
419 0.09
420 0.1
421 0.12
422 0.13
423 0.15
424 0.15
425 0.15
426 0.15
427 0.21
428 0.26
429 0.26
430 0.27
431 0.28
432 0.3
433 0.32
434 0.31
435 0.28
436 0.22
437 0.2
438 0.21
439 0.19
440 0.21
441 0.23