Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3KG51

Protein Details
Accession J3KG51    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
110-129AVPQWGKSARRKQRKFLEFLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto 9.5, cyto_mito 7, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
KEGG cim:CIMG_00038  -  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MSDFPLLAVLHTWYTNFTTNVSNSVSNLTVRDYIRLVWIIGGYMFLRPYLDKGFRRLFEKGVAKSEKAEEAQAEAQAQQAGGAMLTANDLRDGRGNESEDDDDDGGASSAVPQWGKSARRKQRKFLEFLEQEAERRREDDDDRDIADLLED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.17
4 0.17
5 0.2
6 0.21
7 0.23
8 0.24
9 0.22
10 0.19
11 0.21
12 0.2
13 0.17
14 0.17
15 0.16
16 0.18
17 0.18
18 0.19
19 0.17
20 0.17
21 0.18
22 0.18
23 0.16
24 0.12
25 0.11
26 0.1
27 0.09
28 0.09
29 0.07
30 0.07
31 0.07
32 0.06
33 0.07
34 0.07
35 0.09
36 0.13
37 0.2
38 0.21
39 0.27
40 0.32
41 0.34
42 0.38
43 0.37
44 0.33
45 0.34
46 0.38
47 0.34
48 0.36
49 0.36
50 0.32
51 0.32
52 0.31
53 0.26
54 0.21
55 0.19
56 0.12
57 0.13
58 0.13
59 0.12
60 0.11
61 0.09
62 0.09
63 0.08
64 0.08
65 0.05
66 0.04
67 0.04
68 0.03
69 0.03
70 0.03
71 0.02
72 0.03
73 0.03
74 0.03
75 0.04
76 0.05
77 0.05
78 0.09
79 0.1
80 0.12
81 0.15
82 0.17
83 0.17
84 0.19
85 0.19
86 0.17
87 0.18
88 0.15
89 0.12
90 0.1
91 0.1
92 0.07
93 0.06
94 0.05
95 0.04
96 0.05
97 0.07
98 0.07
99 0.07
100 0.1
101 0.16
102 0.22
103 0.31
104 0.41
105 0.5
106 0.61
107 0.67
108 0.74
109 0.79
110 0.81
111 0.78
112 0.72
113 0.73
114 0.63
115 0.6
116 0.55
117 0.46
118 0.4
119 0.42
120 0.4
121 0.3
122 0.29
123 0.29
124 0.28
125 0.32
126 0.36
127 0.34
128 0.35
129 0.36
130 0.36
131 0.34