Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A010S540

Protein Details
Accession A0A010S540    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
18-37YPSAKTRKYNWSEKAKRRKTHydrophilic
NLS Segment(s)
PositionSequence
31-36KAKRRK
Subcellular Location(s) mito 13.5, mito_nucl 13.333, nucl 12, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cfj:CFIO01_10878  -  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
Amino Acid Sequences MSRRSLHIQKHTCSSCGYPSAKTRKYNWSEKAKRRKTVGTGRMRYMKDVSRRFKNGFQSGVPKGSAGPTAQES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.39
3 0.38
4 0.37
5 0.31
6 0.37
7 0.46
8 0.49
9 0.52
10 0.52
11 0.55
12 0.6
13 0.65
14 0.65
15 0.66
16 0.7
17 0.75
18 0.82
19 0.79
20 0.78
21 0.73
22 0.69
23 0.65
24 0.66
25 0.65
26 0.64
27 0.6
28 0.59
29 0.62
30 0.58
31 0.53
32 0.46
33 0.42
34 0.41
35 0.47
36 0.5
37 0.51
38 0.56
39 0.58
40 0.61
41 0.64
42 0.6
43 0.54
44 0.51
45 0.49
46 0.47
47 0.46
48 0.4
49 0.31
50 0.27
51 0.25
52 0.24
53 0.17