Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A010QLX1

Protein Details
Accession A0A010QLX1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
245-268AILGFFLWRKKRKQQRRAGETVPVHydrophilic
NLS Segment(s)
PositionSequence
254-258KKRKQ
Subcellular Location(s) extr 13, plas 9, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG cfj:CFIO01_11193  -  
CDD cd12087  TM_EGFR-like  
Amino Acid Sequences MAIAYPAETDENGTVTSFIALPTAFTPPTSCSTIYRLNGFSLAAYDPGYGIDIDTRVRCAPPAVTTWWEQGRLGLNDGEGHTAVSIGPLVCPERWVTVATSVKNDTSSTLAMCCPQGIAGSVEGDCRSDLLSGAVITYASTSAPDTSSWTMVTSTLTQPGFVGAIAVLGWNIEETAATSTARVAVIDATATPTNAVNVNTPALPRETASTTTLSPSGATPKSVGLPLPTAIGIGVGAAIGVIALAILGFFLWRKKRKQQRRAGETVPVVEEYHARPLEPDKSMSPAPRYHELYAHHTMLSWMGVGRRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.11
4 0.09
5 0.08
6 0.08
7 0.08
8 0.09
9 0.1
10 0.13
11 0.12
12 0.12
13 0.14
14 0.16
15 0.21
16 0.23
17 0.23
18 0.22
19 0.27
20 0.35
21 0.36
22 0.37
23 0.34
24 0.32
25 0.32
26 0.29
27 0.24
28 0.18
29 0.16
30 0.12
31 0.11
32 0.1
33 0.09
34 0.09
35 0.1
36 0.07
37 0.07
38 0.08
39 0.08
40 0.1
41 0.11
42 0.13
43 0.14
44 0.14
45 0.15
46 0.15
47 0.16
48 0.16
49 0.19
50 0.2
51 0.22
52 0.24
53 0.28
54 0.29
55 0.28
56 0.25
57 0.25
58 0.27
59 0.25
60 0.25
61 0.2
62 0.18
63 0.19
64 0.19
65 0.18
66 0.12
67 0.11
68 0.08
69 0.08
70 0.08
71 0.06
72 0.06
73 0.05
74 0.05
75 0.06
76 0.08
77 0.08
78 0.09
79 0.1
80 0.1
81 0.11
82 0.13
83 0.12
84 0.18
85 0.22
86 0.22
87 0.24
88 0.24
89 0.23
90 0.23
91 0.22
92 0.16
93 0.14
94 0.13
95 0.11
96 0.11
97 0.11
98 0.11
99 0.11
100 0.1
101 0.07
102 0.07
103 0.07
104 0.07
105 0.07
106 0.06
107 0.07
108 0.07
109 0.08
110 0.08
111 0.08
112 0.07
113 0.06
114 0.06
115 0.06
116 0.06
117 0.05
118 0.06
119 0.05
120 0.05
121 0.05
122 0.04
123 0.04
124 0.04
125 0.04
126 0.03
127 0.04
128 0.04
129 0.04
130 0.05
131 0.05
132 0.08
133 0.09
134 0.1
135 0.1
136 0.1
137 0.09
138 0.09
139 0.1
140 0.09
141 0.09
142 0.12
143 0.12
144 0.11
145 0.11
146 0.11
147 0.1
148 0.08
149 0.07
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.02
156 0.02
157 0.02
158 0.02
159 0.02
160 0.02
161 0.03
162 0.04
163 0.05
164 0.05
165 0.06
166 0.06
167 0.07
168 0.07
169 0.06
170 0.05
171 0.05
172 0.05
173 0.05
174 0.05
175 0.07
176 0.07
177 0.07
178 0.07
179 0.07
180 0.08
181 0.09
182 0.1
183 0.09
184 0.1
185 0.11
186 0.11
187 0.11
188 0.11
189 0.11
190 0.11
191 0.1
192 0.12
193 0.13
194 0.15
195 0.16
196 0.17
197 0.16
198 0.17
199 0.17
200 0.14
201 0.12
202 0.11
203 0.16
204 0.14
205 0.15
206 0.14
207 0.15
208 0.16
209 0.16
210 0.16
211 0.12
212 0.13
213 0.12
214 0.13
215 0.11
216 0.1
217 0.09
218 0.08
219 0.06
220 0.04
221 0.04
222 0.02
223 0.02
224 0.02
225 0.02
226 0.02
227 0.02
228 0.01
229 0.01
230 0.01
231 0.01
232 0.01
233 0.01
234 0.02
235 0.02
236 0.03
237 0.09
238 0.18
239 0.25
240 0.32
241 0.43
242 0.55
243 0.66
244 0.76
245 0.81
246 0.84
247 0.87
248 0.88
249 0.81
250 0.78
251 0.69
252 0.61
253 0.52
254 0.42
255 0.33
256 0.26
257 0.25
258 0.19
259 0.24
260 0.22
261 0.2
262 0.2
263 0.25
264 0.3
265 0.3
266 0.31
267 0.25
268 0.3
269 0.34
270 0.38
271 0.38
272 0.37
273 0.4
274 0.45
275 0.49
276 0.46
277 0.47
278 0.46
279 0.48
280 0.5
281 0.46
282 0.37
283 0.32
284 0.31
285 0.27
286 0.23
287 0.16
288 0.11
289 0.12