Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A017SPJ0

Protein Details
Accession A0A017SPJ0    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-32TPSASAPQKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
15-24KKKWSKGKVK
Subcellular Location(s) nucl 14, cyto 7, mito 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MEAYKDTPSASAPQKKKWSKGKVKDKAQHAVVLEKSTAEKLNKDVQSYRLITVATLVDRLKINGSLARQALADLEERGVIKKVVGHHDLGIYTRAVAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.63
3 0.7
4 0.74
5 0.76
6 0.78
7 0.84
8 0.86
9 0.86
10 0.9
11 0.88
12 0.84
13 0.81
14 0.71
15 0.64
16 0.54
17 0.49
18 0.39
19 0.33
20 0.26
21 0.19
22 0.18
23 0.16
24 0.18
25 0.14
26 0.14
27 0.16
28 0.24
29 0.25
30 0.26
31 0.26
32 0.25
33 0.29
34 0.3
35 0.27
36 0.2
37 0.18
38 0.16
39 0.15
40 0.14
41 0.09
42 0.09
43 0.08
44 0.09
45 0.09
46 0.1
47 0.1
48 0.1
49 0.1
50 0.11
51 0.13
52 0.15
53 0.15
54 0.15
55 0.14
56 0.13
57 0.13
58 0.11
59 0.11
60 0.08
61 0.08
62 0.09
63 0.09
64 0.1
65 0.11
66 0.1
67 0.1
68 0.12
69 0.17
70 0.22
71 0.24
72 0.25
73 0.25
74 0.27
75 0.27
76 0.26
77 0.22
78 0.16
79 0.14